CAZyme Information: MGYG000002561_00125

Basic Information

• Species: Bacteroides sp902388495
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides sp902388495
• CAZyme ID: MGYG000002561_00125
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783	MGYG000002561_1|CGC5	86463.37	6.7662

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002561	4554549	MAG	China	Asia

• Gene Location: Start: 189797; End: 192148 Strand: +

Full Sequence      

MKRLLTSLFTFCVALAVNAQPTPTLRADNIDEVVNALTLEEKVHLVIGCGMSMGGDTKFP
GTAGRTYDIPRLGIPSAYLADGPHRLAMAAKREFDSHTYHATEFPSSTTVAATFNPDAAY
RVGQALGTEVKDYGMDVLLAPGVNLMRNVLCGRNHEYYAEDPVLVGKIAAAYINGIQSEG
TGTCLKHFAVNNQETNRNNNDSRLTQRPLRELYLKCFEIAVKESQPWSIMTAYNKVNGKY
TCEDRELTEDILRDEWGFKGLVMSDWNAGKDAVASIAAGNDMLQPGQERQYKAILDAVKN
GTLDEALLNLSVKRVLEFVVKSHTFAGYDYPNETDLKAHAQVDREVGAEGIVLLDNKDAL
PMTADIKKVALYGTTSYDMVPAGMGFGSTGFGYYTVSMVEGLRNAGYAVDKELLDRYKKH
LADEQKRLFPKGRPPFSFTAPPRAEEFLPSAEEMAAQVRENDIAVLTLGRTSGEGCDRRV
KEFYLKENELALIKQVSAAYRAAGKKLVVILNICSPVETASWKGLADAVVCAFQPGQEVG
NSITDVLAGKVNPSGKLPMTFAVKYGDAPSDANFPFDYEFRMPSFAMGTGMNFKSDKKEE
KPKEPERNVDFTLYEEGVYVGYRYFDTFGKEVSYPFGHGLSYTTFDYAVEEAAMDGDRCR
MKVSVKNTGKVAGREAVQLYVKAPKGGLDKPAKELKAFGKTRLLQPGESQTLTLEWNAMD
MASYNEKTSSWELAKGEYQWMAAASSADVRCTVTQKVIKACKQKTHNAMKAQLPITQHSM
VRR

Enzyme Prediction     

No EC number prediction in MGYG000002561_00125.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	69	283	6.1e-71	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	1.92e-68	1	750	1	758	beta-glucosidase BglX.
COG1472	BglX	5.72e-67	37	379	1	367	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.76e-41	351	578	1	212	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
PLN03080	PLN03080	7.06e-37	7	698	38	725	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	9.07e-37	101	317	85	315	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT61357.1	0.0	1	783	1	788
QQA29846.1	0.0	1	783	1	788
QUT37185.1	0.0	1	783	1	788
QUT65953.1	0.0	1	783	1	788
QBJ18650.1	0.0	1	783	1	788

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2X40_A	3.37e-213	28	757	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	5.41e-212	28	757	2	713	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
7MS2_A	1.60e-121	27	749	2	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.39e-108	27	749	2	655	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
3AC0_A	1.65e-74	29	759	5	838	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	8.79e-121	27	749	2	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
E7CY69	3.70e-108	34	753	9	668	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
F6C6C1	1.02e-107	34	754	9	669	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
Q5BFG8	2.50e-101	30	749	11	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
A7LXS8	3.78e-91	7	759	17	747	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999091	0.000181	0.000162	0.000162	0.000148

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002561_00125.