CAZyme Information: MGYG000002560_03293

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_03293
• CAZy Family: GH28
• CAZyme Description: Exo-poly-alpha-D-galacturonosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
539	MGYG000002560_26|CGC1	59196.49	5.5861

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 23666; End: 25285 Strand: +

Full Sequence      

MISFIKKILLLPAACVLPLLTGCNNCPSTIAVEDIIDPAIYAQLPFQMDKVEQPTFPDYS
VNIIDFGAKPDGITLNTKAINDAIRNVNEKGGGKVIIPAGLWLSGPIEILSNVNLHTEKN
ALVLFTADHSQYPIINTSFEGLETRRCQSPISARNAENIAITGHGTFDGNGDTWRPTKKD
KLTEGQWKKLVSSGGVVDPDGRIWYPSEGALKGAMLSKDNFNVPRGTLTDADWDYMRDWL
RPVLLSFIKCNKVLLEGATFKNSPSWCLHPLSCENITINKVTVSNPWYSQNGDALDLESC
NKALIINNSFDAGDDGICIKSGKDEQGRKRGEPCQNVIVMNNTVLHGHGGFVVGSEMSGG
VKNIYVDNCNFLGTDVGLRFKSNRGRGGVVENIYISNINMINIPNEALIFNLYYGGKARG
EETDQDDRKVEETIPAVTEETPVFRNIFIKNVTCKGAGRAAFFNGLPEMRIKNINMENII
VSNAKEGIILNEADEVSMKNIKIELLKDGANLKMQKVSNVTINGKNYSEIGAKGEELNF

Enzyme Prediction     

No EC number prediction in MGYG000002560_03293.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	88	503	1.3e-84	0.963076923076923

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG5434	Pgu1	2.33e-82	54	403	76	398	Polygalacturonase [Carbohydrate transport and metabolism].
pfam00295	Glyco_hydro_28	6.36e-21	190	521	56	316	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
PLN03003	PLN03003	2.68e-17	60	418	23	306	Probable polygalacturonase At3g15720
PLN02218	PLN02218	3.88e-14	60	447	67	378	polygalacturonase ADPG
PLN03010	PLN03010	2.37e-12	245	413	160	320	polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY38157.1	0.0	1	539	1	539
ABR39657.1	0.0	1	539	1	539
QQY41451.1	0.0	1	539	1	539
QUT59403.1	0.0	1	539	1	539
QEW37987.1	0.0	1	539	1	539

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3JUR_A	7.37e-75	48	537	15	446	Thecrystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_B The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_C The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima],3JUR_D The crystal structure of a hyperthermoactive Exopolygalacturonase from Thermotoga maritima [Thermotoga maritima]
5OLP_A	4.37e-62	40	477	24	421	Galacturonidase[Bacteroides thetaiotaomicron VPI-5482],5OLP_B Galacturonidase [Bacteroides thetaiotaomicron VPI-5482]
2UVE_A	3.21e-32	61	414	157	501	Structureof Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVE_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase [Yersinia enterocolitica],2UVF_A Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica],2UVF_B Structure of Yersinia enterocolitica Family 28 Exopolygalacturonase in Complex with Digalaturonic Acid [Yersinia enterocolitica]
1BHE_A	3.41e-17	69	413	19	314	ChainA, POLYGALACTURONASE [Pectobacterium carotovorum]
4MXN_A	3.53e-15	58	284	21	190	Crystalstructure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_B Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_C Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184],4MXN_D Crystal structure of a putative glycosyl hydrolase (PARMER_00599) from Parabacteroides merdae ATCC 43184 at 1.95 A resolution [Parabacteroides merdae ATCC 43184]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7PZL3	1.28e-37	59	467	61	410	Probable polygalacturonase OS=Vitis vinifera OX=29760 GN=GSVIVT00026920001 PE=1 SV=1
P15922	6.87e-32	61	414	152	494	Exo-poly-alpha-D-galacturonosidase OS=Dickeya chrysanthemi OX=556 GN=pehX PE=1 SV=1
P27644	1.58e-29	245	469	25	248	Polygalacturonase OS=Rhizobium radiobacter OX=358 GN=pgl PE=2 SV=1
P18192	1.25e-17	69	413	45	340	Endo-polygalacturonase OS=Pectobacterium carotovorum subsp. carotovorum OX=555 GN=peh PE=3 SV=1
Q9LW07	1.36e-16	60	416	23	304	Probable polygalacturonase At3g15720 OS=Arabidopsis thaliana OX=3702 GN=At3g15720 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000078	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_03293.