CAZyme Information: MGYG000002560_02339

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_02339
• CAZy Family: GH105
• CAZyme Description: Unsaturated rhamnogalacturonyl hydrolase YteR

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000002560_12|CGC1	46711.4	8.0131

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 99864; End: 101093 Strand: -

Full Sequence      

MKKKSICKFIVSGLLVAAPLVSMAQSVCGNKPWSVRMAESEMARCPESWQLDFQTRLKWD
YCHGLELQSMLDVYDAYGDKKFFDYAVAYADTMIHKDGSIVTYKLDEYNIDRLNSGKMLF
RIYEQTKDEKYKKALDLLRSQLDTHPRNADGGLWHKKIYENQMWLDGLYMGQPFYAEYAY
RNSRVGDYADIINQFVTVARHCYDPKTDLYRHACDVSKREKWADKATGQSQHCWGRAMGW
YAMACVDVLDFLPEHEAGRDSVIAILNKLAAQIKRTQDSQTGVWYQVIDRSGDEGNYLES
SCSTMFVYTLLKALRKGYICPSYMAVAKKGYEGILRQFIEVDDKGLVSITNACAVAGLGG
KPTYRTGDYNYYITEKIRSNDAKAVAPFIMASLEWERLFQKGGCGSACK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	51	397	4.9e-120	0.9849397590361446

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.89e-123	33	399	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.41e-100	53	399	28	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ABR39473.1	1.00e-289	1	409	1	409
QQY38334.1	1.00e-289	1	409	1	409
QUT59627.1	1.00e-289	1	409	1	409
QQY41712.1	1.00e-289	1	409	1	409
ALK82868.1	2.02e-289	1	409	1	409

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4WU0_A	8.90e-109	59	398	23	361	StructuralAnalysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824],4WU0_B Structural Analysis of C. acetobutylicum ATCC 824 Glycoside Hydrolase From Family 105 [Clostridium acetobutylicum ATCC 824]
1NC5_A	7.50e-79	58	403	38	372	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	3.13e-78	58	403	28	362	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]
3K11_A	2.74e-20	147	398	183	413	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	1.37e-16	59	337	65	331	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	4.11e-78	58	403	38	372	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P0A3U6	2.83e-40	170	394	1	227	Protein Atu3128 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=Atu3128 PE=3 SV=1
P0A3U7	2.83e-40	170	394	1	227	24.9 kDa protein in picA locus OS=Rhizobium radiobacter OX=358 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000597	0.998442	0.000353	0.000214	0.000186	0.000168

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_02339.