CAZyme Information: MGYG000002560_02338

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_02338
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316	MGYG000002560_12|CGC1	35972.86	7.6203

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 98898; End: 99848 Strand: -

Full Sequence      

MKRTLGLLLFLMVVCGAWAQQRQDTIVVSRDGTGKYRTLQEAIESARAFMDYTVTIYVKN
GVYKEKLIVPSWLENIDIIGEDRDKTIITYDDHANINKMGTFRTYTVKVEGNHITFRNLT
IENNAAQLGQAVALHTEGDCLKFINCRILGNQDTIYTGMPFTRLYFKDCYIEGTTDFIFG
PSTALFEDCTIHSKRNSYVTAASTPKEAKYGYVFKHCKLTAAPGVDKVYLGRPWRPYGYT
LFMECELGDHIVSAGWHNWGKQSNEETARYMEYKNTGEGANVSERVKWSKQLTKKEADAV
TNDAIFCTHSTWSPKD

Enzyme Prediction     

No EC number prediction in MGYG000002560_02338.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	26	304	2e-104	0.9791666666666666

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01095	Pectinesterase	1.71e-79	26	301	2	290	Pectinesterase.
PLN02773	PLN02773	1.55e-78	20	298	1	288	pectinesterase
PLN02682	PLN02682	4.28e-69	25	297	70	352	pectinesterase family protein
COG4677	PemB	4.62e-67	23	306	80	402	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
PLN02432	PLN02432	1.72e-66	26	297	13	277	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AND21864.1	9.15e-214	1	316	1	316
QUT87309.1	9.50e-214	1	316	2	317
ALA73615.1	1.85e-213	1	316	1	316
QJR75357.1	1.85e-213	1	316	1	316
QJR56781.1	1.85e-213	1	316	1	316

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1GQ8_A	9.15e-47	26	312	9	307	Pectinmethylesterase from Carrot [Daucus carota]
1XG2_A	5.55e-44	27	288	6	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	8.72e-35	26	285	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	4.65e-34	26	285	11	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
3UW0_A	1.71e-31	3	306	11	358	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9LVQ0	5.51e-59	28	297	9	287	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q8GXA1	4.77e-56	11	315	243	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9FJ21	2.04e-53	26	314	260	560	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q8VYZ3	1.49e-51	27	297	87	366	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q84JX1	2.72e-50	17	305	207	503	Probable pectinesterase/pectinesterase inhibitor 19 OS=Arabidopsis thaliana OX=3702 GN=PME19 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001790	0.831178	0.166071	0.000356	0.000293	0.000280

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_02338.