CAZyme Information: MGYG000002560_00347

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_00347
• CAZy Family: GH109
• CAZyme Description: Glycosyl hydrolase family 109 protein 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411	MGYG000002560_1|CGC7	46991.73	6.1541

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 436485; End: 437720 Strand: +

Full Sequence      

MKLPNVLNLTCPPIPIVRIGFIGLGKRGILALERYMHLEGIEVKALCDLRRENVERAEHI
LNEFGRPQAENYSEEGMWRKMCECKEIDLIYICTDWLTHTDIAVYAMQQGRHVALEVPAA
MSVADCWRLVDTAEATRRHCMMLENCCYDAFALTTLNMVQQGVLGEITHAEGAYIHDLRK
HYFADETAGGYHNNWMKLYSQQHTGNPYPTHGLGPVCQWMNIHRGDRMEYLVSMSSRQAG
LSAYAGQVFGRHSQEAGQVYEMGDVNTTLIHTVKGKTILLQYDVTTPRPYSRHQTICGTK
GFMQKYPVPCLLLDDYGKEPLAGEAFEKVMECYKHPFTASIGEEARRKNMPNEMNYIMDY
RLIHCLRNGLPLDQDVYDAAEWSCITELSEQSVRQGSVPVEIPDFTRGYWE

Enzyme Prediction     

No EC number prediction in MGYG000002560_00347.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	14	411	3.8e-168	0.9874686716791979

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	1.53e-20	17	190	4	177	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	2.27e-15	17	142	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK11579	PRK11579	5.75e-04	87	171	65	149	putative oxidoreductase; Provisional
COG4091	COG4091	0.004	16	115	17	131	Predicted homoserine dehydrogenase, contains C-terminal SAF domain [Amino acid transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQY42665.1	7.44e-298	1	411	1	411
QQY39397.1	3.03e-297	1	411	1	411
ABR38319.1	3.03e-297	1	411	1	411
ALK82695.1	3.03e-297	1	411	1	411
QEW35077.1	8.68e-297	1	411	1	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6T2B_A	2.42e-90	8	411	34	439	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
2IXA_A	1.22e-60	17	411	21	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
1EVJ_A	3.37e-12	22	167	8	150	ChainA, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_B Chain B, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_C Chain C, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis],1EVJ_D Chain D, GLUCOSE-FRUCTOSE OXIDOREDUCTASE [Zymomonas mobilis]
1OFG_A	2.22e-11	22	167	37	179	ChainA, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_B Chain B, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_C Chain C, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_D Chain D, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_E Chain E, Glucose-fructose Oxidoreductase [Zymomonas mobilis],1OFG_F Chain F, Glucose-fructose Oxidoreductase [Zymomonas mobilis]
1RYD_A	2.27e-11	22	167	43	185	ChainA, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYD_B Chain B, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_A Chain A, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_B Chain B, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_C Chain C, glucose-fructose oxidoreductase [Zymomonas mobilis],1RYE_D Chain D, glucose-fructose oxidoreductase [Zymomonas mobilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A6KY05	6.06e-298	1	411	1	411	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1
Q89ZW9	8.06e-224	5	411	9	415	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4252 PE=3 SV=1
Q5LGW9	8.63e-218	1	411	1	414	Alpha-N-acetylgalactosaminidase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=BF0874 PE=3 SV=1
Q64XS1	3.50e-217	1	411	1	414	Glycosyl hydrolase family 109 protein 2 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0955 PE=3 SV=1
P0C863	7.01e-139	5	410	42	452	Glycosyl hydrolase family 109 protein 1 OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=BF0931 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_00347.