CAZyme Information: MGYG000002560_00292

Basic Information

• Species: Phocaeicola sp902388365
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Phocaeicola; Phocaeicola sp902388365
• CAZyme ID: MGYG000002560_00292
• CAZy Family: GH27
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
674	MGYG000002560_1|CGC6	75786.01	4.7306

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002560	5390440	MAG	China	Asia

• Gene Location: Start: 347240; End: 349264 Strand: +

Full Sequence      

MKNNRSTLKSLLFCVSAWAVSGCILSGCAEKTLNAGEWSLAYDTEANGIDITKGSKLVYD
NLYASYKLSDSLVSTRDYQKHTVSTEKIEDAFGEGYLYKVTYTGNGLPVLVQSFYVYSDK
DYVLSDFTLEGVSEIASNYMAPVNVDRMPEILEKGENNRTLFIPFDNDCWIRYQSHPLTF
TDLTSYEVTAVFNNEDRKGIVVGSVEHDNWKTGITIGKGNIYNVGSLVCYGGAADKTTRD
SKPHGALKGTKVKSPKVLLGFFEDWREGLEDYARANAVIAPPKAWGKAVPFGWNSWGALQ
FNLTYPKALEVSDYYKQNLQNNHFVNADNLVYIGLDSGWNSFSEEELKDFVDRCKANGQV
AGVYWTPFTDWGKNPEREIKEIPGCKYKDVYLYANGQPQELDGAYAVDPTHPAVEAMMKS
TSELFHRAGFEYVKMDFMTHGAMEADKWYNPEIQTGIQGYNYGMKLLDKYFGDMYINLSI
SPVFPAQYAQSRRIACDAWNKMKDTEYTLNALSYGWWQDKVYQFNDPDHIVLREATDGEN
RARVTSGVITGLFIAGDDFSKGGPKEVKEKAMAYMTNAEINAVANGESFRPVDGNGEKSE
NQFIRIDKDGKAYYAVFNYAEEELKMTVALERLGLDAAKEYKLKELWSGAESTAQTNLEV
TVPALDVAIFRIEE

Enzyme Prediction     

No EC number prediction in MGYG000002560_00292.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	420	651	4.1e-16	0.9432314410480349

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	6.51e-13	290	558	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam17801	Melibiase_C	3.85e-10	608	672	12	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
cd14792	GH27	7.52e-06	290	583	2	268	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AII65845.1	0.0	1	674	1	675
QQY38591.1	0.0	1	674	1	675
ABR38452.1	0.0	1	674	1	675
ALK83137.1	0.0	1	674	1	675
QJR69930.1	0.0	1	674	1	675

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000035	0.999994	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002560_00292.