CAZyme Information: MGYG000002558_02432

Basic Information

• Species: Prevotella sp900540415
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Prevotella; Prevotella sp900540415
• CAZyme ID: MGYG000002558_02432
• CAZy Family: GT23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
288		31347.81	9.8366

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002558	3471678	MAG	China	Asia

• Gene Location: Start: 5705; End: 6571 Strand: +

Full Sequence      

MKTTNHKGSLTLVPAGGLANRMRAVASAYRLCLAVGSRLHVVWFRDWALNAPFADIFEPI
AAPGIDLREAGVADAIVNGRPRRRNLWLPALPQALAYQRRIYEKSVTPLKQRGFDFEAWA
AGRRCYMSCYQEFGAYPDDTYRLLFRPVASVMRSVEANAGLFADYTIGMHIRRTDHGEAT
AQSPTSLFIEAGRRELAAHPGLKIFLATDDQGVKAELTAEFGSRVITAAAAASRSSADGI
RGGLADMYTLARTQRIYGSAGSSFSPMAARIGGVEMIEVRAGRGGEQC

Enzyme Prediction     

No EC number prediction in MGYG000002558_02432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT23	16	277	9e-16	0.8459119496855346

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd11548	NodZ_like	1.14e-44	9	273	1	282	Alpha 1,6-fucosyltransferase similar to Bradyrhizobium NodZ. Bradyrhizobium NodZ is an alpha 1,6-fucosyltransferase involved in the biosynthesis of the nodulation factor, a lipo-chitooligosaccharide formed by three-to-six beta-1,4-linked N-acetyl-d-glucosamine (GlcNAc) residues and a fatty acid acyl group attached to the nitrogen atom at the non-reducing end. NodZ transfers L-fucose from the GDP-beta-L-fucose donor to the reducing residue of the chitin oligosaccharide backbone, before the attachment of a fatty acid group. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.
cd11296	O-FucT_like	2.99e-04	124	271	36	200	GDP-fucose protein O-fucosyltransferase and related proteins. O-fucosyltransferase-like proteins are GDP-fucose dependent enzymes with similarities to the family 1 glycosyltransferases (GT1). They are soluble ER proteins that may be proteolytically cleaved from a membrane-associated preprotein, and are involved in the O-fucosylation of protein substrates, the core fucosylation of growth factor receptors, and other processes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AGB28478.1	1.07e-104	6	280	2	274
QJR65871.1	9.77e-73	8	276	2	271
QJR70901.1	9.77e-73	8	276	2	271
AII66011.1	9.77e-73	8	276	2	271
QJR78650.1	9.77e-73	8	276	2	271

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002558_02432.