CAZyme Information: MGYG000002557_00365

Basic Information

• Species: Collinsella sp902388345
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp902388345
• CAZyme ID: MGYG000002557_00365
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
721	MGYG000002557_5|CGC1	79006.96	4.9876

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002557	2163992	MAG	China	Asia

• Gene Location: Start: 50113; End: 52278 Strand: +

Full Sequence      

MSGKEQLFEVSLEREGAYRSISAALEAAERCVPDVTVPVRVLVAPGEYRERVEIRRPHVT
LEGETADSVRIVGGLGAKMPSEDGSGQDGRLGTFRTYTVLVDADDVTLAGLTIENNAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPLREAKPGGFIGPKQFAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAVSTPQGEPYGFVFHGCSFT
ADEGIAPGSVYLGRPWREWAQTVLLECWLGPHISLEGWWDWNKPAAHDGTLYAGGALFGP
AGDTAAWVPWAHCLTGQDSERYARDRVLAGTDGWDPEGGDGDAVETAGLSANGRTVHIET
YYEDEPALRARLKREGRSAAFTGKTPTDFEAWKAATRTRLYDILGLSLMDRAPIEIRELN
RVRVAGSIVRTHAVLQVEHDVWMPFYLLEPSRPKLDERGLKRCYICPHGHQGAGAASIAG
VAGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDARGWGYRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLSALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLVAPRPLLVQSCEKDHLN
GARGLANVDEQLDIVRDAYALLGKDENLLHEVCPGGHHLGVAHLAEDIEWLDSQVAECAH
A

Enzyme Prediction     

No EC number prediction in MGYG000002557_00365.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	328	2e-76	0.9791666666666666
CE19	457	698	3.5e-26	0.5993975903614458

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	4.56e-62	18	330	94	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	4.25e-48	16	311	10	275	Pectinesterase.
PLN02990	PLN02990	4.66e-40	10	337	263	562	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	1.62e-39	7	319	12	277	putative pectinesterase
PLN02708	PLN02708	1.89e-39	16	336	251	550	Probable pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP54718.1	0.0	1	721	1	721
QIA34433.1	0.0	1	719	1	719
QUC03567.1	0.0	9	717	8	711
QRP39805.1	7.63e-103	10	336	20	349
ASN95501.1	7.63e-103	10	336	20	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	5.02e-26	18	288	44	310	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
1XG2_A	3.35e-25	10	315	7	284	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	7.44e-23	15	278	16	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.36e-22	15	278	16	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
2NSP_A	3.75e-22	18	288	18	286	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	4.64e-37	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q43062	3.60e-29	10	310	211	482	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q43043	9.77e-29	10	334	61	359	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1
O81320	1.32e-27	10	311	167	437	Putative pectinesterase/pectinesterase inhibitor 38 OS=Arabidopsis thaliana OX=3702 GN=PME38 PE=3 SV=1
Q8L7Q7	1.62e-27	18	311	301	575	Probable pectinesterase/pectinesterase inhibitor 64 OS=Arabidopsis thaliana OX=3702 GN=PME64 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002557_00365.