CAZyme Information: MGYG000002556_01394

Basic Information

• Species: CAG-279 sp000437795
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-279; CAG-279 sp000437795
• CAZyme ID: MGYG000002556_01394
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364	MGYG000002556_8|CGC2	40744.07	8.2689

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002556	2634532	MAG	China	Asia

• Gene Location: Start: 88970; End: 90064 Strand: -

Full Sequence      

MKVVVTGTRGIPNIMGGVETHCEELFPRIAAAGHDVTVIRRSCYVGDDNHISSYKGVALK
DIYAPRKKSLEAIVHTFLAVLSARRMHADILHIHAIGPSLMTPFARLLGLKVVTTHHGPD
YDRQKWGVFAKFMLKAGERMGAMFSNEVIVISHVIEDILHRKYGRDSNLIFNGVTTPEKS
SATDYIEGLGLESRKYVVAVGRFVKEKGFDLLIDAFKASDMSKNFKLVIAGDADHEDEYS
QMLKKKAKDSGVVLTGFIRGERLNQILTNAALFVLPSYHEGLPISLLEAMSYNIDVVVSD
IPANKLPELDSADFFRCGEMDSLTKVLNQKEKNLVQERVYDLTNYDWNHIAEQTIAVYKK
AMRK

Enzyme Prediction     

No EC number prediction in MGYG000002556_01394.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	192	303	2.1e-26	0.7

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	6.21e-52	2	359	1	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	6.43e-36	1	364	1	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.34e-33	2	356	1	362	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03820	GT4_AmsD-like	3.63e-32	11	302	6	288	amylovoran biosynthesis glycosyltransferase AmsD and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. AmSD in Erwinia amylovora has been shown to be involved in the biosynthesis of amylovoran, the acidic exopolysaccharide acting as a virulence factor. This enzyme may be responsible for the formation of galactose alpha-1,6 linkages in amylovoran.
cd03819	GT4_WavL-like	1.41e-31	14	303	9	289	Vibrio cholerae WavL and similar sequences. This family is most closely related to the GT4 family of glycosyltransferases. WavL in Vibrio cholerae has been shown to be involved in the biosynthesis of the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64460.1	1.30e-167	1	362	1	362
AHF12040.1	3.53e-165	1	360	1	360
QUT23979.1	2.78e-147	1	359	1	357
QNL37901.1	3.71e-145	1	359	1	357
ACT91325.1	1.40e-144	1	364	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TVP_A	2.38e-09	1	360	15	398	Structureof Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155],6TVP_B Structure of Mycobacterium smegmatis alpha-maltose-1-phosphate synthase GlgM [Mycolicibacterium smegmatis MC2 155]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	8.64e-17	1	362	1	385	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
O32272	1.99e-13	65	301	90	316	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1
Q65CC7	3.91e-10	85	360	87	383	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
Q4H4F8	9.42e-10	80	319	77	324	2-deoxystreptamine N-acetyl-D-glucosaminyltransferase OS=Niallia circulans OX=1397 GN=btrM PE=3 SV=1
A0R2E2	1.26e-08	1	360	1	384	Alpha-maltose-1-phosphate synthase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=glgM PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000049	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002556_01394.