CAZyme Information: MGYG000002551_00110

Basic Information

• Species: Haemophilus_A paraphrohaemolyticus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Pasteurellaceae; Haemophilus_A; Haemophilus_A paraphrohaemolyticus
• CAZyme ID: MGYG000002551_00110
• CAZy Family: GT35
• CAZyme Description: Glycogen phosphorylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
592	MGYG000002551_3|CGC1	68006.04	6.2123

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002551	1748237	MAG	China	Asia

• Gene Location: Start: 13326; End: 15104 Strand: +

Full Sequence      

MPFKHFTLTSKLDRVDILGYKKESKNYLNLFDIQALNYNLIENGIEFDKTKIKENLTLFL
YPDDSDKNGELLRIYQQYFMVSNAAQLLIDEAIERGSNLHDLADYAYVQINDTHPSMVIP
ELIRLLTKKHHLKFDEAVEIVRNMVGYTNHTILAEALEKWPLAYLNEVVPHLVVIIKKLD
QLVRKAYKDPAVQIIDEHKRVHMAHMDIHFSNSVNGVAALHTEILKNSELKAFYAIYPEK
FNNKTNGITFRRWLEFSNQELAAYIKVLIGEGYLHDATELEKLLAFKDDKAVHQKLAEIK
FNNKLALKKYLKENKGIELDEHSIIDTQIKRFHEYKRQQMNALYVIHKYLEIKAGKLPKR
KITVIFGGKAAPAYIIAQDIIHLILCLSELINNDPEVNQYLNVFLVENYNVSVAEKLIPA
TDISEQISLASKEASGTGNMKFMLNGALTLGTMDGANVEIAELAGAENIYTFGKDSESII
KLYETAGYISKDYYEADKNIQQAVDFILNPAIVKLGNETRLTRLYNELLNKDWFMTLIDF
NAYVKAKEQILADYEDQDSWNEKVVQNIAKAGFFSSDRTIAQYNADIWHCEG

Enzyme Prediction     

EC	2.4.1.1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT35	15	590	1.5e-188	0.8308605341246291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0058	GlgP	0.0	9	589	177	747	Glucan phosphorylase [Carbohydrate transport and metabolism].
TIGR02093	P_ylase	0.0	15	589	202	793	glycogen/starch/alpha-glucan phosphorylases. This family consists of phosphorylases. Members use phosphate to break alpha 1,4 linkages between pairs of glucose residues at the end of long glucose polymers, releasing alpha-D-glucose 1-phosphate. The nomenclature convention is to preface the name according to the natural substrate, as in glycogen phosphorylase, starch phosphorylase, maltodextrin phosphorylase, etc. Name differences among these substrates reflect differences in patterns of branching with alpha 1,6 linkages. Members include allosterically regulated and unregulated forms. A related family, TIGR02094, contains examples known to act well on particularly small alpha 1,4 glucans, as may be found after import from exogenous sources. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
cd04300	GT35_Glycogen_Phosphorylase	0.0	5	589	195	794	glycogen phosphorylase and similar proteins. This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of oligosaccharides into glucose-1-phosphate units. They are important allosteric enzymes in carbohydrate metabolism. The allosteric control mechanisms of yeast and mammalian members of this family are different from that of bacterial members. The members of this family belong to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam00343	Phosphorylase	0.0	15	589	121	660	Carbohydrate phosphorylase. The members of this family catalyze the formation of glucose 1-phosphate from one of the following polyglucoses; glycogen, starch, glucan or maltodextrin.
PRK14985	PRK14985	2.83e-161	54	588	252	794	maltodextrin phosphorylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEN11753.1	0.0	1	592	164	755
QRP12950.1	0.0	1	592	164	755
VEI29580.1	0.0	1	592	164	755
QOR20895.1	0.0	1	592	666	1257
QOR17155.1	0.0	1	592	164	755

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4L22_A	0.0	1	589	168	756	Crystalstructure of putative glycogen phosphorylase from Streptococcus mutans [Streptococcus mutans UA159]
2FFR_A	2.76e-138	19	591	221	817	Crystallographicstudies on N-azido-beta-D-glucopyranosylamine, an inhibitor of glycogen phosphorylase: comparison with N-acetyl-beta-D-glucopyranosylamine [Oryctolagus cuniculus]
2GJ4_A	1.06e-137	19	591	221	817	Structureof rabbit muscle glycogen phosphorylase in complex with ligand [Oryctolagus cuniculus]
2GM9_A	1.09e-137	19	591	221	817	Structureof rabbit muscle glycogen phosphorylase in complex with thienopyrrole [Oryctolagus cuniculus],5MCB_A Glycogen phosphorylase in complex with chlorogenic acid. [Oryctolagus cuniculus],7ONF_A Chain A, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]
7O8E_A	1.24e-137	19	591	226	822	ChainA, Glycogen phosphorylase, muscle form [Oryctolagus cuniculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P29849	9.92e-292	1	589	164	750	Maltodextrin phosphorylase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=malP PE=3 SV=2
P73511	1.01e-137	17	588	237	824	Glycogen phosphorylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=glgP PE=3 SV=1
P00489	9.51e-137	19	591	233	829	Glycogen phosphorylase, muscle form OS=Oryctolagus cuniculus OX=9986 GN=PYGM PE=1 SV=3
P39123	4.51e-136	15	588	213	792	Glycogen phosphorylase OS=Bacillus subtilis (strain 168) OX=224308 GN=glgP PE=2 SV=1
O18751	7.21e-136	19	591	233	829	Glycogen phosphorylase, muscle form OS=Ovis aries OX=9940 GN=PYGM PE=2 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000045	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002551_00110.