CAZyme Information: MGYG000002549_03422

Basic Information

• Species: Bacteroides caccae
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides; Bacteroides caccae
• CAZyme ID: MGYG000002549_03422
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase BoGH2A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
702	MGYG000002549_17|CGC3	80990.59	8.8405

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002549	5479119	Isolate	United States	North America

• Gene Location: Start: 118052; End: 120160 Strand: +

Full Sequence      

MKFKFTFVLLVLIGQFFSLTAREVTSFNEGWLFKRGPFSEDPVKVVAQWEGKWETVNLPH
TWNAKDMQVKAASFYEGVGYYKKKQFFNEELKGKRVFLRFEGVGANTEVYVNSKLVGTHK
GGYSAFAFEIGTALKFGAENEIMVKADNTARPDVIPVNHSLFGVYGGIYRPVWLIITEQN
NITVTDCASPGVYITQKNVSKRSADITVKVKLDNGSLTPANLVLENTLYTQEGKRVASHR
LPLELTPQGTQTYFSTFKLNKPHLWQGRKDPYLYKVVSRLVAEGRVIDEVIQPLGVRKFE
VVAGKGFYLNDEKYPMYGVTRHQDWWGLGSALTNKEHDFDLAQIMDVGATTVRFAHYQQS
DYLYSRCDSLGLVIWAEIPFVNRVTGYEAENAQSQLRELIRQSFNHPSIYVWGLHNEVYQ
PHEYTAGLTQALHNLAKTEDPDRYTVAVNGFGHAEHAVNQNTDIQGMNRYFGWYEKKLQD
IEPWVKGLEEKYPWQKLMLTEYGADANLEHQTEYLGDALNWGKPFYPETFQTKTHEYQWS
VISKHPYIIASYLWNMFDFAVPMWSRGGVPARNLKGLMTFDRKIKKDSYYWYKANWSKEP
VLYLTQRRNADRERKQTSVTVYSNIGTPIVYLNGKELTGIRKGYTDVHYVFDNVTLEQGK
NVIRTVATHNGKEYTDEIEWNYTGEKKRNADSRENKNEHAGW

Enzyme Prediction     

No EC number prediction in MGYG000002549_03422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	20	611	1e-90	0.625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	1.22e-55	22	600	10	596	beta-D-glucuronidase; Provisional
COG3250	LacZ	1.31e-41	22	421	10	410	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	5.17e-24	79	443	111	470	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	3.67e-16	302	600	3	269	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam02837	Glyco_hydro_2_N	7.50e-14	26	175	3	166	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU06739.1	0.0	1	702	1	702
QRP59648.1	0.0	1	702	1	702
QQT78467.1	0.0	1	702	1	702
ASM65015.1	0.0	1	702	1	702
QUT40945.1	0.0	1	702	1	702

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FN9_A	0.0	21	701	4	684	Crystalstructure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_B Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_C Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343],3FN9_D Crystal structure of putative beta-galactosidase from bacteroides fragilis [Bacteroides fragilis NCTC 9343]
5Z1A_A	9.36e-144	18	682	19	674	Thecrystal structure of Bacteroides fragilis beta-glucuronidase in complex with uronic isofagomine [Bacteroides fragilis NCTC 9343]
3CMG_A	3.55e-143	19	682	1	655	Crystalstructure of putative beta-galactosidase from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
6MVG_A	2.30e-121	16	652	19	632	Crystalstructure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_B Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus],6MVG_C Crystal structure of FMN-binding beta-glucuronidase from Ruminococcus gnavus [[Ruminococcus] gnavus]
6MVH_A	7.40e-120	16	677	19	651	Crystalstructure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_B Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_C Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis],6MVH_D Crystal structure of FMN-binding beta-glucuronidase from Roseburia hominis [Roseburia hominis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPJ7	2.15e-86	21	682	50	720	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
T2KN75	2.79e-50	22	660	26	664	Beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22060 PE=1 SV=1
A7LXS9	1.62e-49	19	672	39	727	Beta-galactosidase BoGH2A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02645 PE=1 SV=1
P77989	2.62e-48	22	438	3	409	Beta-galactosidase OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) OX=340099 GN=lacZ PE=3 SV=2
T2KM09	2.29e-45	8	637	31	664	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000238	0.999157	0.000170	0.000151	0.000138	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002549_03422.