CAZyme Information: MGYG000002547_02140

Basic Information

• Species: Megasphaera elsdenii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera elsdenii
• CAZyme ID: MGYG000002547_02140
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000002547_20|CGC1	48060.42	8.3346

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002547	2429033	Isolate	India	Asia

• Gene Location: Start: 6084; End: 7334 Strand: +

Full Sequence      

MEHILDIIMIPIQVIIVFYSLYYFILACFGLMKRRERITVAPKNTFAAVICAHNEEKVVW
QLIDNLKQLNYPKDMYDIYVVADNCTDHTADICREHGAIVKVRTNKEQVGKGYALDWMFS
QMLAQEKQYDAFVVFDADNLVHPEFLREMNNHLCKGEKVIQGYMDSKNPTDSWIAGTFSI
AFWLINHMWHLAKYNIGLSTALGGTGMCIATEIVRKYGWGCDCLTEDMEFSMKVLLEGVR
TCWAHDAIIYDEKVVGFMQSCRQRKRWAQGQCDCGERFIPKLFARGIKTGNIRMLDGIIT
LSQPFFMMASTIYAVLASINSYLPFYTNILNAIVPVQIWTIIGVGQYLIPVIVLLQIKVP
PKSWAYLIIYPIFMYSWIPVNFLGFKDRHKMKWSHTLHTRALSYESAALLRKENKK

Enzyme Prediction     

No EC number prediction in MGYG000002547_02140.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	45	268	4.7e-29	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06438	EpsO_like	6.20e-94	49	230	2	183	EpsO protein participates in the methanolan synthesis. The Methylobacillus sp EpsO protein is predicted to participate in the methanolan synthesis. Methanolan is an exopolysaccharide (EPS), composed of glucose, mannose and galactose. A 21 genes cluster was predicted to participate in the methanolan synthesis. Gene disruption analysis revealed that EpsO is one of the glycosyltransferase enzymes involved in the synthesis of repeating sugar units onto the lipid carrier.
cd06423	CESA_like	6.78e-39	49	227	2	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.08e-33	17	385	20	397	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
pfam13641	Glyco_tranf_2_3	1.59e-24	44	270	2	230	Glycosyltransferase like family 2. Members of this family of prokaryotic proteins include putative glucosyltransferase, which are involved in bacterial capsule biosynthesis.
cd06439	CESA_like_1	1.91e-22	19	252	2	229	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALG41124.1	1.01e-313	1	416	1	416
AVO73714.1	1.01e-313	1	416	1	416
CCC72243.1	1.01e-313	1	416	1	416
AVO26544.1	8.27e-313	1	416	1	416
AXB81531.1	1.66e-287	1	415	1	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P61_A	1.29e-06	45	153	14	117	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.57e-16	33	283	40	292	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8YMK0	2.17e-10	49	270	111	333	Beta-monoglucosyldiacylglycerol synthase OS=Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) OX=103690 GN=all4933 PE=1 SV=1
Q3MB01	9.00e-10	49	270	111	333	Beta-monoglucosyldiacylglycerol synthase OS=Trichormus variabilis (strain ATCC 29413 / PCC 7937) OX=240292 GN=Ava_2217 PE=1 SV=1
P74165	9.20e-10	39	270	103	335	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1
P37786	5.56e-06	47	157	8	107	Protein RfbJ OS=Shigella flexneri OX=623 GN=rfbJ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000002	0.000000	0.000000	0.000000	0.000001

TMHMM  Annotations     

start	end
10	32
297	319
334	356
363	385