CAZyme Information: MGYG000002547_00309

Basic Information

• Species: Megasphaera elsdenii
• Lineage: Bacteria; Firmicutes_C; Negativicutes; Veillonellales; Megasphaeraceae; Megasphaera; Megasphaera elsdenii
• CAZyme ID: MGYG000002547_00309
• CAZy Family: GT9
• CAZyme Description: Lipopolysaccharide heptosyltransferase 1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
343	MGYG000002547_2|CGC1	38351.25	8.4253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002547	2429033	Isolate	India	Asia

• Gene Location: Start: 23879; End: 24910 Strand: -

Full Sequence      

MKAYKNILVIKMSSLGDVLHALPTLYALRQNCPDARIVWAVHEQFAPVLPGRPYIDEVIY
VDKKRLKSLSYWKELRRTLHAFHFDVSFDLQGLAKSAIVAFLSGARERYGYWEMREGSFL
VSKGLTGPHKYDHVIERYLDTVRVLGGRVDAVEFPLPDICGEKQAWRQRLAADGLTGPYV
AIVPGARWNVKEWPLSHWQAFLQRLTASGMAAVLLGSGDDVPKGKALKDHDSSGRVFDYT
GRTDLRQLMAAIAESTLYISADTGPLHIANALKKELIALFGPTCPQRTGPYGGNDDAYIH
MVLSPTSQATPERPLVDDPDCMAQITPDMLWQVYEGVLKKVKL

Enzyme Prediction     

No EC number prediction in MGYG000002547_00309.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	300	1.6e-55	0.8888888888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.19e-79	5	342	2	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	1.22e-65	6	332	1	273	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.80e-41	72	313	1	237	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10964	PRK10964	1.69e-29	7	339	3	321	lipopolysaccharide heptosyltransferase RfaC.
TIGR02195	heptsyl_trn_II	2.40e-28	6	338	1	333	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCC73398.1	8.38e-260	1	343	1	343
AVO74797.1	8.38e-260	1	343	1	343
AVO27633.1	2.40e-259	1	343	1	343
ALG42174.1	9.79e-259	1	343	1	343
AXL20516.1	2.89e-194	1	340	1	340

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GT1_A	1.18e-22	6	294	2	293	E.coli heptosyltransferase WaaC. [Escherichia coli UTI89],2GT1_B E. coli heptosyltransferase WaaC. [Escherichia coli UTI89]
6DFE_A	1.18e-22	6	294	2	293	Thestructure of a ternary complex of E. coli WaaC [Escherichia coli],6DFE_B The structure of a ternary complex of E. coli WaaC [Escherichia coli]
2H1F_A	1.32e-22	6	294	2	293	E.coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1F_B E. coli heptosyltransferase WaaC with ADP [Escherichia coli O6],2H1H_A E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218],2H1H_B E. coli heptosyltransferase WaaC with ADP-2-deoxy-2-fluoro heptose [Escherichia coli RS218]
3TOV_A	1.40e-18	4	291	8	298	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]
1PSW_A	3.44e-16	6	290	2	297	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P26469	1.58e-22	6	297	2	296	Lipopolysaccharide heptosyltransferase 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaC PE=3 SV=2
P24173	4.24e-22	6	313	2	315	Lipopolysaccharide heptosyltransferase 1 OS=Escherichia coli (strain K12) OX=83333 GN=rfaC PE=1 SV=1
P37692	2.99e-18	6	290	2	297	ADP-heptose--LPS heptosyltransferase 2 OS=Escherichia coli (strain K12) OX=83333 GN=rfaF PE=1 SV=1
P25742	3.91e-18	16	283	5	279	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
P45042	1.38e-17	6	290	2	297	ADP-heptose--LPS heptosyltransferase 2 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=rfaF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000074	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002547_00309.