CAZyme Information: MGYG000002546_02402

Basic Information

• Species: Neobittarella massiliensis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Neobittarella; Neobittarella massiliensis
• CAZyme ID: MGYG000002546_02402
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
663	MGYG000002546_2|CGC2	76587	6.0918

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002546	3225359	Isolate	United Kingdom	Europe

• Gene Location: Start: 154574; End: 156565 Strand: -

Full Sequence      

MEKETKTSAEYSLEQSLQYYREKYKQLQEENVELTYTCARYRKQCEEMLCSTSWRVTRPL
RAIKTAVYKIAHSNRVLLLMWRGLSYLKNQGVVSFFKKLWTVVAGERSSHSELGKKLTKK
QLEEQRARRFEKQICISILVPLYNTDIAFLREMLDSVVRQTYPNWQLCLADGSDRDQAEI
EAVVAQYQKDNQRILYRVLEENRGISENTNACAQMATGDFLALLDHDDILAPNALFEIVS
AYNETGAQFIYTDEAMFERRITRILGYNLKSDYAPDTLRSYNYICHLSCFDKRLFEQVGG
FRSKCDGSQDYDLVLRITEIANHVYHIPKVLYYWRSHPLSVASDISAKPYCLAAARTALA
DHLARVGLEGTVEDSTVLSTYKIRYALKGTPLISILIPNCDHVEDLRLCVNSILGLSTYE
NYEIIVIENNSTDPETFRYYAQLEESDRVQVVYWKDTFNYSAINNFGFQYAKGEYILLLN
NDMEVISPDWMQEMLMFAQRDDVGAVGAKLYYPDDTVQHAGVILGIGGVAGHALKGSRRD
EPGFMTRLQIAQDLSAVTAACMMIPRRVYQQVHGLDEGFEVAFNDVDLCMRIRQAGYLIV
FTPYAELYHYESKSRGYEDTKEKQMRFSGEVKRFTDRWQKQLDAGDPYYNSNLTLKREDF
SLR

Enzyme Prediction     

No EC number prediction in MGYG000002546_02402.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	137	250	4.2e-24	0.6529411764705882
GT2	394	571	1.3e-20	0.9823529411764705

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04184	GT2_RfbC_Mx_like	1.14e-89	135	335	2	201	Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis. The rfbC gene encodes a predicted protein of 1,276 amino acids, which is required for O-antigen biosynthesis in Myxococcus xanthus. It is a subfamily of Glycosyltransferase Family GT2, which includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds.
cd04186	GT_2_like_c	7.92e-45	395	611	1	166	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	3.48e-32	389	616	1	226	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
cd06433	GT_2_WfgS_like	1.85e-25	137	340	1	199	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
pfam00535	Glycos_transf_2	1.81e-23	137	251	1	112	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUC66692.1	3.28e-238	41	663	325	946
CAB1243278.1	4.07e-231	6	663	371	1033
QMW89744.1	2.37e-217	63	663	11	615
BBK78193.1	2.37e-217	63	663	11	615
ACD24731.1	4.82e-212	47	663	486	1106

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5HEA_A	2.29e-08	136	247	7	114	CgTstructure in hexamer [Streptococcus parasanguinis FW213],5HEA_B CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEA_C CgT structure in hexamer [Streptococcus parasanguinis FW213],5HEC_A CgT structure in dimer [Streptococcus parasanguinis FW213],5HEC_B CgT structure in dimer [Streptococcus parasanguinis FW213]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P55465	8.89e-144	128	662	360	897	Uncharacterized protein y4gI OS=Sinorhizobium fredii (strain NBRC 101917 / NGR234) OX=394 GN=NGR_a03550 PE=4 SV=1
Q50864	3.48e-88	124	663	309	841	O-antigen biosynthesis protein RfbC OS=Myxococcus xanthus OX=34 GN=rfbC PE=4 SV=1
Q1RIM7	5.46e-16	136	482	15	379	Uncharacterized glycosyltransferase RBE_0706 OS=Rickettsia bellii (strain RML369-C) OX=336407 GN=RBE_0706 PE=3 SV=1
Q4UM29	2.32e-14	136	502	16	400	Uncharacterized glycosyltransferase RF_0543 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) OX=315456 GN=RF_0543 PE=3 SV=1
P71054	1.80e-09	136	332	7	204	Putative glycosyltransferase EpsE OS=Bacillus subtilis (strain 168) OX=224308 GN=epsE PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002546_02402.