CAZyme Information: MGYG000002545_00939

Basic Information

• Species: Faecalibacterium prausnitzii_G
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Ruminococcaceae; Faecalibacterium; Faecalibacterium prausnitzii_G
• CAZyme ID: MGYG000002545_00939
• CAZy Family: GT2
• CAZyme Description: N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
263	MGYG000002545_1|CGC6	29723.87	7.758

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002545	2833887	Isolate	Ireland	Europe

• Gene Location: Start: 972900; End: 973691 Strand: -

Full Sequence      

MELSACIVVYNGCDEALKAAQTVLQYTRRHPLTLYLVDNASPDGSGARLEAAVKGGTLST
QPGQKVEVRCRKENGGFGTGHNTVLSELTSDYHFILNPDIQLTADTLSDLADWMAAHPDA
VMARPGLRFPDGRSQSLPLRRCALRPMVYRQLPFLKFWEKYNRAYLMEGEDLSAPVEIEF
CTGSFSAVRTAEFKAVGGFDEHYFMYVEDADLTQKMRTTGKAYLVPQYTAIHAWHRAAHR
SLKPFLWQTGSLLRYFHKWGFQF

Enzyme Prediction     

No EC number prediction in MGYG000002545_00939.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	4	190	5.5e-16	0.9529411764705882

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04186	GT_2_like_c	4.16e-34	7	232	3	164	Subfamily of Glycosyltransferase Family GT2 of unknown function. GT-2 includes diverse families of glycosyltransferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.
COG1216	GT2	4.95e-30	1	261	3	249	Glycosyltransferase, GT2 family [Carbohydrate transport and metabolism].
pfam00535	Glycos_transf_2	6.87e-11	4	157	1	147	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG1215	BcsA	1.13e-08	35	226	88	258	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd00761	Glyco_tranf_GTA_type	1.22e-08	7	123	3	111	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXA81612.1	2.53e-198	1	263	1	263
ATO99476.1	1.40e-154	1	262	1	262
QIA42132.1	1.40e-154	1	262	1	262
ATL89682.1	1.40e-154	1	262	1	262
CBL00721.1	1.34e-152	1	261	1	261

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P9WMY2	5.36e-13	24	244	25	245	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=wbbL PE=3 SV=2
P9WMY3	5.36e-13	24	244	25	245	N-acetylglucosaminyl-diphospho-decaprenol L-rhamnosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=wbbL PE=1 SV=2
P36667	1.11e-11	75	255	58	243	Rhamnosyltransferase WbbL OS=Escherichia coli (strain K12) OX=83333 GN=wbbL PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002545_00939.