CAZyme Information: MGYG000002541_01493

Basic Information

• Species: Cardiobacterium valvarum
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Cardiobacteriales; Cardiobacteriaceae; Cardiobacterium; Cardiobacterium valvarum
• CAZyme ID: MGYG000002541_01493
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
339	MGYG000002541_104|CGC1	37211.66	10.8035

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002541	2547857	Isolate	not provided	not provided

• Gene Location: Start: 14377; End: 15396 Strand: -

Full Sequence      

MRGLVLSLSLLAALPAVAAPTALTPMTAQRSPVTTAEDNLPDLYRQAAARHGVDATTLYR
HMLDRTRWVNTHGQTVAWPWTVEVQGRRYQFKTRIDCFNWLLGKRGKATGITFGLDGRRL
ALQSRSTLWAELDVAAMVERSAKALRPQPLPQPQTSGKPDTSSSPIPPVNENPALQAMIA
RVSRETGVDELLLHAVIYQESRYKIGARSPKGAMGLMQLMPGTARDLGLAPHEYYDPYRN
LWGGATYLKQQLSTFPTLEAALAAYNAGPQAVRRHKGVPPYRETQQYVAAIGGHYRRLQA
VRQTGASPVPAKTGERRVASAQDVAPALLNPPGQKRGLR

Enzyme Prediction     

No EC number prediction in MGYG000002541_01493.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	191	300	2.5e-28	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	4.19e-40	192	296	3	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	2.27e-31	179	288	10	139	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	4.47e-29	183	297	12	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13403	MLTF-like	2.82e-26	181	274	3	101	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	1.09e-24	187	274	9	101	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAD6438461.1	2.72e-36	172	295	81	202
CAD6630998.1	2.72e-36	172	295	81	202
ANV25494.1	2.72e-36	172	295	81	202
CCF22119.1	2.72e-36	172	295	81	202
QRF54679.1	2.72e-36	172	295	81	202

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	1.09e-10	179	312	420	567	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
6FPN_B	1.10e-10	179	312	430	577	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O1J_A	1.10e-10	179	312	424	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	1.11e-10	179	312	434	581	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	1.11e-10	179	312	440	587	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.43e-25	174	295	59	179	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	2.89e-25	188	297	1435	1543	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	2.89e-25	188	297	1435	1543	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	8.45e-11	179	268	11	98	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q1QZB1	5.35e-10	173	282	288	408	Membrane-bound lytic murein transglycosylase F OS=Chromohalobacter salexigens (strain ATCC BAA-138 / DSM 3043 / CIP 106854 / NCIMB 13768 / 1H11) OX=290398 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000340	0.998957	0.000163	0.000198	0.000167	0.000154

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002541_01493.