CAZyme Information: MGYG000002540_02825

Basic Information

• Species: Paraprevotella clara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella clara
• CAZyme ID: MGYG000002540_02825
• CAZy Family: GT4
• CAZyme Description: Glycosyltransferase Gtf1

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
336	MGYG000002540_53|CGC1	38907.39	9.3964

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002540	4187245	Isolate	not provided	not provided

• Gene Location: Start: 2341; End: 3351 Strand: -

Full Sequence      

MTNGGIENMLSDIINCQVSHCDVALVVINDAVDETILNRIDKRCHVIRIGRKLKSRSPWF
IIKLNYILWKGRYDILHVHNDGFLKYIFYKGRRIATIHNSGFSSLKYSGCKVLACISKAV
YDEMTKAGYKNCVRVDNGINVQSILRRRIDFYEGQLKIVQVSRLLLKQKGQDILLKALSL
LKHRGLENFTLDFIGSGVDEVELKKMVVELNLEKHVRFLGNQSREYVYSHLKDYDLFVQP
SRFEGFGLTVAEAMAACVPVLVSKNEGPLEIIDYGKYGYDFKNDNIHECSEKIAMFLFKK
NDLTVIRKALQHVSERYNIETMVRQYLMLYDKMLRQ

Enzyme Prediction     

No EC number prediction in MGYG000002540_02825.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	154	300	7.4e-35	0.9

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03811	GT4_GT28_WabH-like	5.39e-47	1	319	9	351	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03808	GT4_CapM-like	6.87e-45	13	327	20	358	capsular polysaccharide biosynthesis glycosyltransferase CapM and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. CapM in Staphylococcus aureus is required for the synthesis of type 1 capsular polysaccharides.
cd03801	GT4_PimA-like	1.50e-44	3	330	13	365	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.78e-38	46	336	86	380	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	1.12e-35	154	297	1	142	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATR99196.1	5.22e-80	4	332	14	344
ATR93279.1	1.01e-74	4	327	13	340
ATS08282.1	1.01e-74	4	327	13	340
ATS06983.1	1.11e-72	4	327	16	347
ATR90492.1	2.86e-72	4	327	13	344

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4X6L_A	2.27e-11	72	331	244	492	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_C Chain C, TarM [Staphylococcus aureus subsp. aureus 21178],4X6L_D Chain D, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7P_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4X7M_A	2.27e-11	72	331	244	492	ChainA, TarM [Staphylococcus aureus subsp. aureus 21178],4X7M_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_A Chain A, TarM [Staphylococcus aureus subsp. aureus 21178],4X7R_B Chain B, TarM [Staphylococcus aureus subsp. aureus 21178]
4WAC_A	2.28e-11	72	331	249	497	CrystalStructure of TarM [Staphylococcus aureus],4WAD_A Crystal Structure of TarM with UDP-GlcNAc [Staphylococcus aureus]
2R60_A	4.11e-10	176	327	293	453	Structureof apo Sucrose Phosphate Synthase (SPS) of Halothermothrix orenii [Halothermothrix orenii],2R66_A Complex Structure of Sucrose Phosphate Synthase (SPS)-F6P of Halothermothrix orenii [Halothermothrix orenii H 168],2R68_A Complex Structure of Sucrose Phosphate Synthase (SPS)-S6P of Halothermothrix orenii [Halothermothrix orenii H 168]
5E9T_A	2.33e-09	175	299	338	460	Crystalstructure of GtfA/B complex [Streptococcus gordonii],5E9T_C Crystal structure of GtfA/B complex [Streptococcus gordonii],5E9U_A Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_C Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_E Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii],5E9U_G Crystal structure of GtfA/B complex bound to UDP and GlcNAc [Streptococcus gordonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
D4H6M0	4.90e-12	203	318	611	736	Sucrose synthase OS=Denitrovibrio acetiphilus (strain DSM 12809 / NBRC 114555 / N2460) OX=522772 GN=Dacet_2944 PE=1 SV=1
I7A3T6	6.66e-11	203	318	613	738	Sucrose synthase OS=Melioribacter roseus (strain JCM 17771 / P3M-2) OX=1191523 GN=MROS_1314 PE=1 SV=1
A0A0H2WWV6	1.24e-10	72	331	244	492	Poly(ribitol-phosphate) alpha-N-acetylglucosaminyltransferase OS=Staphylococcus aureus (strain COL) OX=93062 GN=tarM PE=1 SV=1
A7TZT2	1.18e-09	142	277	239	378	Mannosylfructose-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=mfpsA PE=1 SV=1
P26388	1.90e-09	138	325	205	398	Putative colanic acid biosynthesis glycosyltransferase WcaL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=wcaL PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000028	0.000009	0.000002	0.000000	0.000000	0.000001

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002540_02825.