CAZyme Information: MGYG000002540_01437

Basic Information

• Species: Paraprevotella clara
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Paraprevotella; Paraprevotella clara
• CAZyme ID: MGYG000002540_01437
• CAZy Family: GT32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
235	MGYG000002540_22|CGC4	27913.23	8.444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002540	4187245	Isolate	not provided	not provided

• Gene Location: Start: 184480; End: 185187 Strand: -

Full Sequence      

MIPKKIHYCWFGHNQKTQSMLRYIDTWKKCFPDYEIKEWNEGNFDVDQLNFTREAYFAKK
YAFVSDVCRLYALYSEGGIYLDTDVIILKTFPDKLRSHKAFAGFEHEINIGTGIMGSEKN
NPIIKEFLQCYNDMHFFKGIRYSLIPNVNLFTDILAKHGLKRNNTYQDLNDIVIYPQNIF
CCKDCRTKEYYNVSESLSIHDFAGLWIDSRNSLYKRICFRLKELMTVIKYRGLLI

Enzyme Prediction     

No EC number prediction in MGYG000002540_01437.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	21	95	2.3e-20	0.9111111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3774	OCH1	6.02e-13	1	122	81	205	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
pfam04488	Gly_transf_sug	2.80e-12	22	102	6	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
pfam12919	TcdA_TcdB	6.94e-05	50	84	159	193	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam12919	TcdA_TcdB	0.004	4	71	1	81	TcdA/TcdB catalytic glycosyltransferase domain. This domain represents the N-terminal glycosyltransferase from a set of toxins found in some bacteria. This domain in TcdB glycosylates the host RhoA protein.
pfam05704	Caps_synth	0.009	1	125	45	182	Capsular polysaccharide synthesis protein. This family consists of several capsular polysaccharide proteins. Capsular polysaccharide (CPS) is a major virulence factor in Streptococcus pneumoniae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYR65866.1	8.39e-69	1	215	1	215
AZS31711.1	1.79e-65	1	227	1	224
ALJ57662.1	3.95e-65	1	221	1	222
AST58537.1	3.30e-64	2	229	5	228
BBK91625.1	9.25e-63	1	233	1	244

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MIX_A	2.24e-06	2	128	49	215	PaToxGGlycosyltransferase [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949],4MIX_B PaToxG Glycosyltransferase [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5UQW4	7.17e-08	1	206	1	211	Uncharacterized glycosyltransferase L373 OS=Acanthamoeba polyphaga mimivirus OX=212035 GN=MIMI_L373 PE=3 SV=1
Q5ZU30	1.44e-07	2	101	28	153	Subversion of eukaryotic traffic protein A OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) OX=272624 GN=setA PE=1 SV=1
P0C8Q4	4.71e-07	65	180	463	573	Uncharacterized protein At4g19900 OS=Arabidopsis thaliana OX=3702 GN=At4g19900 PE=2 SV=1
Q10323	3.90e-06	2	155	57	214	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000073	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002540_01437.