CAZyme Information: MGYG000002536_02344

Basic Information

• Species: Plesiomonas shigelloides
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Plesiomonas; Plesiomonas shigelloides
• CAZyme ID: MGYG000002536_02344
• CAZy Family: CBM73
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1017	MGYG000002536_30|CGC4	110924.25	5.5408

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002536	3653255	Isolate	not provided	not provided

• Gene Location: Start: 154916; End: 157969 Strand: +

Full Sequence      

MEMSYLSCLIAASLVTAALPVSANDTSPLYFNSIQPKNDLVGKLEAKVQFAQSQILPSKA
LEGDRQPILTSLRKSLILVQPLQPDAVTPMFVDARDSRGALLGTVTLAPPSALPETVYHL
PGVPAGGVNFTPESGETRVINSSAELAKLDDKNGAFLKERLATSALVEIQTADGRWVRDI
YLPQGAELEGKMVRMRSRAGYNSNLYYGERKVTVSNGQTIAFKYANGQWFREGELENNRL
SYAPDTWSGELPAEWIVPGLTLSVRQGNLTGELTDIPVGAPGELLLHTIDIGMLVEPRDR
FSFAKDFDAQREYFQTLPARRMVVNQYAPLYLPEVMLPNGTLLTDFDPSDGGWHGGTMRQ
RIGKELISHGIDNANYGINSSAGEGEGSHPFVVAQLAAHNSRGKYANGVQVHGGSGGGGI
VTLDNSLGNEFSHEVGHNFGLGHYVDGFRGSVHRSADQINSTWGWDSDKLRFIPNFFPRQ
NQAETCLDGQCQLPFDGRQFGKDAMAGGEPFSAANRFTLYTPNSAALIQRFFASKAVFDS
QSPTGFSKWNADTARMEPYQHTVEGLETVNAPVDNLSAENLAQLLSEYELVKIGMWNGHW
ARNIYMPAASGENRGRSISIDHRAGYNSHLFINGSEILVSNGYKKTFTSDGQRWQERAEV
NTRVARQPQRFEIPVTTLVGYYDPQARQQSYIYPALHAAYGFTYPDDNATLSSNDCQLQV
ETRDSVLRFKLLNHRASSAVMNKFHINVPSDSQPSKARVVCNNRTLSETPLSAAPTDLVY
TINGKLPETEGGGECSSAWRAEATYVGGDLASHNGKSWRAEWWTQGEEPGTTGEWGVWRL
QGDSDCSGGVTPPPVTGSSDFTLSNFDSRYTLINGQVSIRLNLTTQNPVQIAARLQQNGQ
RFGEVSAQVNGNSALTLAVSNASAGSYELVIEGKAEGQQPVVQRHTVTLSEDNQGGGSEG
DYPAYVAGNSYQAGDRVSNSGANYECKPWPYSGWCGLSPAHYAPGTGSAWSDAWQRL

Enzyme Prediction     

No EC number prediction in MGYG000002536_02344.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM73	964	1015	1.9e-22	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam10462	Peptidase_M66	2.58e-82	236	537	1	306	Peptidase M66. This family of metallopeptidases contains StcE, a virulence factor found in Shiga toxigenic Escherichia coli organisms. StcE peptidase cleaves C1 esterase inhibitor.
pfam12561	TagA	1.44e-43	666	761	1	99	ToxR activated gene A lipoprotein. This domain family is found in bacteria, and is approximately 140 amino acids in length. The family is found in association with pfam10462. There is a conserved GAG sequence motif. This family is a bacterial lipoprotein.
PRK13211	PRK13211	3.84e-29	854	1017	306	477	N-acetylglucosamine-binding protein GbpA.
cd12215	ChiC_BD	2.29e-15	798	840	2	42	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.
smart00495	ChtBD3	1.55e-11	798	838	3	41	Chitin-binding domain type 3.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
SBT60336.1	0.0	1	1017	1	1017
QIY09655.1	0.0	1	1017	1	1017
QWK97752.1	0.0	1	1017	1	1017
QWK95134.1	0.0	1	1017	1	1017
AVQ87060.1	0.0	1	1017	1	1017

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UJZ_A	0.0	22	793	6	778	Crystalstructure of enterohemorrhagic E. coli StcE [Escherichia coli O157:H7]
4DNY_A	7.09e-47	119	238	7	126	Crystalstructure of enterohemorrhagic E. coli StcE(132-251) [Escherichia coli O157:H7]
4HMC_A	7.40e-12	799	839	488	528	Crystalstructure of cold-adapted chitinase from Moritella marina [Moritella marina],4HMD_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction intermediate - oxazolinium ion (NGO) [Moritella marina],4HME_A Crystal structure of cold-adapted chitinase from Moritella marina with a reaction product - NAG2 [Moritella marina]
4MB3_A	7.40e-12	799	839	488	528	Crystalstructure of E153Q mutant of cold-adapted chitinase from Moritella marina [Moritella marina],4MB4_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag4 [Moritella marina],4MB5_A Crystal structure of E153Q mutant of cold-adapted chitinase from Moritella complex with Nag5 [Moritella marina]
6Z41_A	3.32e-07	963	1017	7	57	ChainA, Carbohydrate binding protein, putative, cpb33A [Cellvibrio japonicus Ueda107]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O82882	0.0	1	793	13	807	Metalloprotease StcE OS=Escherichia coli O157:H7 OX=83334 GN=stcE PE=1 SV=2
P0C6Q7	2.82e-55	236	537	231	535	ToxR-activated gene A lipoprotein OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=tagA PE=3 SV=1
A5F398	8.97e-55	236	537	231	535	ToxR-activated gene A lipoprotein OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=tagA PE=3 SV=2
Q3JLY2	1.83e-20	236	570	192	535	Dictomallein OS=Burkholderia pseudomallei (strain 1710b) OX=320372 GN=dtmL PE=3 SV=2
A2RWR9	1.83e-20	236	570	192	535	Dictomallein OS=Burkholderia mallei (strain NCTC 10229) OX=412022 GN=dtmL PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000188	0.999229	0.000144	0.000155	0.000141	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002536_02344.