CAZyme Information: MGYG000002534_00111

Basic Information

• Species: Citrobacter_A farmeri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter_A; Citrobacter_A farmeri
• CAZyme ID: MGYG000002534_00111
• CAZy Family: GT8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
338	MGYG000002534_1|CGC5	39569.47	7.1026

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002534	5715629	Isolate	Australia	Oceania

• Gene Location: Start: 114688; End: 115704 Strand: +

Full Sequence      

MDSFPEIEIAEYKVFDERYDNNDNTLHISYGIDENYLDGVGVSITSVLIHNDINVDFHII
CDKYTQSFVDKIAALTQEHKIKISLYLINVKCLEILPKTQVWSRAMYFRLFAFDYLYHKL
DKLLYLDADVICKGPLDDLLNLDLNDNVAAVVKDVDSIQSRVNERLPSFNLQGRYFNSGV
VLINLRQWAEHRLTERALSLLTGEDGNAIFFKYPDQDVLNILLRDKVYFLPREYNTIYTI
KSELSDKTHEKYLDVIHAETKLIHFTGATKPWHAWANYPSVIYYTNAFIKSPWKDVPAKD
ARTMVEYKKRYKHLLVQKHYLRGMIAGVTYLYRKILAK

Enzyme Prediction     

EC	2.4.1.58

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT8	21	275	1.7e-57	0.8988326848249028

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15171	PRK15171	1.06e-86	15	336	15	334	lipopolysaccharide 3-alpha-galactosyltransferase.
COG1442	RfaJ	2.09e-75	24	338	1	320	Lipopolysaccharide biosynthesis protein, LPS:glycosyltransferase [Cell wall/membrane/envelope biogenesis].
cd04194	GT8_A4GalT_like	1.55e-63	26	273	1	247	A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The members of this family of glycosyltransferases catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface. The enzymes exhibit broad substrate specificities. The known functions found in this family include: Alpha-1,4-galactosyltransferase, LOS-alpha-1,3-D-galactosyltransferase, UDP-glucose:(galactosyl) LPS alpha1,2-glucosyltransferase, UDP-galactose: (glucosyl) LPS alpha1,2-galactosyltransferase, and UDP-glucose:(glucosyl) LPS alpha1,2-glucosyltransferase. Alpha-1,4-galactosyltransferase from N. meningitidis adds an alpha-galactose from UDP-Gal (the donor) to a terminal lactose (the acceptor) of the LOS structure of outer membrane. LOSs are virulence factors that enable the organism to evade the immune system of host cells. In E. coli, the three alpha-1,2-glycosyltransferases, that are involved in the synthesis of the outer core region of the LPS, are all members of this family. The three enzymes share 40 % of sequence identity, but have different sugar donor or acceptor specificities, representing the structural diversity of LPS.
pfam01501	Glyco_transf_8	7.05e-62	27	276	1	252	Glycosyl transferase family 8. This family includes enzymes that transfer sugar residues to donor molecules. Members of this family are involved in lipopolysaccharide biosynthesis and glycogen synthesis. This family includes Lipopolysaccharide galactosyltransferase, lipopolysaccharide glucosyltransferase 1, and glycogenin glucosyltransferase.
pfam08437	Glyco_transf_8C	3.88e-17	279	332	1	54	Glycosyl transferase family 8 C-terminal. This domain is found at the C-terminus of the pfam01501 domain in bacterial glucosyltransferase and galactosyltransferase proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AST77684.1	1.88e-249	1	338	1	338
QZE44923.1	4.36e-239	1	338	1	338
QFS69390.1	1.56e-232	1	338	1	338
AKE60611.1	1.74e-229	1	338	1	338
AUO66847.1	5.00e-229	1	338	1	338

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TZT_A	1.07e-19	32	272	12	252	Thestructure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548],3TZT_B The structure of a protein in glycosyl transferase family 8 from Anaerococcus prevotii. [Anaerococcus prevotii DSM 20548]
6U4B_A	8.28e-19	23	294	299	589	ChainA, WbbM protein [Klebsiella pneumoniae]
1SS9_A	2.08e-12	26	273	1	253	ChainA, alpha-1,4-galactosyl transferase [Neisseria meningitidis]
5GVW_A	6.01e-12	121	273	100	236	Crystalstructure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_B Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_C Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVW_D Crystal structure of the apo-form glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]
5GVV_A	1.08e-11	121	273	100	236	Crystalstructure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae],5GVV_F Crystal structure of the glycosyltransferase GlyE in Streptococcus pneumoniae TIGR4 [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P19817	9.81e-172	1	338	1	336	Lipopolysaccharide 1,2-glucosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaJ PE=3 SV=4
P27129	1.72e-132	1	338	1	338	Lipopolysaccharide 1,2-glucosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaJ PE=3 SV=2
P19816	3.73e-58	27	336	29	336	Lipopolysaccharide 1,3-galactosyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaI PE=3 SV=4
P27128	1.70e-56	15	335	18	337	Lipopolysaccharide 1,3-galactosyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=rfaI PE=3 SV=1
P43974	5.85e-18	25	273	38	279	Putative glycosyltransferase HI_0258 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_0258 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000068	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002534_00111.