CAZyme Information: MGYG000002532_03518

Basic Information

• Species: Enterovibrio hollisae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Vibrionaceae; Enterovibrio; Enterovibrio hollisae
• CAZyme ID: MGYG000002532_03518
• CAZy Family: GT30
• CAZyme Description: 3-deoxy-D-manno-octulosonic acid transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
419		46093.91	9.9312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002532	4096279	Isolate	not provided	not provided

• Gene Location: Start: 3832253; End: 3833512 Strand: +

Full Sequence      

MRILYTLLLALAAPFLLLGLYRTKDNKPKVGKRWVEHFGRTPALKGDNPIWVHAVSVGEV
IAAKPVIEALKKRYPNIAVLVTTTTATGADIASKIEGIEHRYMPIDFGFAVRGFLKNTHP
RLMLIMETELWPNTLTAVKKAGIPIIVMNARLSEKSKRGYQRIKPLFNLLSRNINHILCQ
FDDDARRFLELGVAKENVSVSGSMKFDLPKFDIDSPAVTALIRQVTGRPVWIAASTHPGE
DEIVLAAHKIITEIAPDALLILVPRHPERFGEVARLIESRGFVLARRSLGQTIGPDTRVY
LGDTMGEMMNLLAVSDVTLMAGSLIGEKVGGHNLLEPASLAKPLITGPSYFNFQVIAEQL
IESGACTVCDNSHHIAQQVISLFKDEEKRRKAGEAALGVVDKNRGAVKKTLDALAPWLG

Enzyme Prediction     

EC	2.4.99.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT30	32	208	4.6e-65	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05749	PRK05749	0.0	26	418	27	421	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed
COG1519	KdtA	2.68e-152	27	418	27	419	3-deoxy-D-manno-octulosonic-acid transferase [Cell wall/membrane/envelope biogenesis].
pfam04413	Glycos_transf_N	7.74e-72	36	208	2	176	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase). Members of this family transfer activated sugars to a variety of substrates, including glycogen, fructose-6-phosphate and lipopolysaccharides. Members of the family transfer UDP, ADP, GDP or CMP linked sugars. The Glycos_transf_N region is flanked at the N-terminus by a signal peptide and at the C-terminus by Glycos_transf_1 (pfam00534). The eukaryotic glycogen synthases may be distant members of this bacterial family.
pfam00534	Glycos_transf_1	1.34e-07	242	396	18	155	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AMG30453.1	2.00e-301	1	419	1	419
QCF36950.1	5.76e-170	1	418	1	415
QIR05043.1	1.64e-169	1	418	1	415
QCP01085.1	3.54e-169	1	418	1	415
ATD28533.1	1.07e-162	1	411	3	415

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4BFC_A	1.18e-31	228	418	42	231	ChainA, 3-DEOXY-D-MANNO-OCTULOSONIC-ACID TRANSFERASE [Acinetobacter baumannii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AC75	1.11e-97	1	418	2	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli (strain K12) OX=83333 GN=waaA PE=1 SV=1
P0AC77	1.11e-97	1	418	2	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O157:H7 OX=83334 GN=waaA PE=3 SV=1
P0AC76	1.11e-97	1	418	2	420	3-deoxy-D-manno-octulosonic acid transferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=waaA PE=3 SV=1
P44806	2.63e-90	2	418	3	423	3-deoxy-D-manno-octulosonic acid transferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=waaA PE=1 SV=1
Q45374	2.82e-69	5	419	6	428	3-deoxy-D-manno-octulosonic acid transferase OS=Bordetella pertussis OX=520 GN=waaA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.975545	0.023661	0.000552	0.000076	0.000048	0.000137

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002532_03518.