CAZyme Information: MGYG000002531_03193

Basic Information

• Species: Pseudobutyrivibrio fibrisolvens_A
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Pseudobutyrivibrio; Pseudobutyrivibrio fibrisolvens_A
• CAZyme ID: MGYG000002531_03193
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
783		86461.37	5.2845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002531	3116879	Isolate	not provided	not provided

• Gene Location: Start: 3001908; End: 3004259 Strand: -

Full Sequence      

MDAKEIISKLTLMEKAALLSGKNEWESRDIPRLGVNSITFSDGPHGLRRQEGAGDHLGLN
ASLPATCFPTAATVANSWDPEIGEKIGAALGEEAVAQNVDVLLGPGLNMKRSPLCGRNFE
YFSEDPILAGKMAAAYVRGIQSKHVYSCPKHFAVNSREYRRMAMNAVVDERTLREIYLTA
FEIAVKEGGAKTIMSAYNEVNGKYANENEHLLVDILRNEWGFDGIVVTDWGASNDHVAGV
KCQSNVEMPNPGLDSARELLAAVEDGRITEEEIDKAILPVIEAAIYFKDNDHTKGFDKEA
HHAIAKEALINSAVLLKNDEDILPLKAGAKVCLKGPFVEKPRYQGSGSSQVNSTKVETIA
DQIKNYDLTVVENPSEADVVLFFFGLDEIAESEGGDRMSIDVPEYQIKELESLAVANKHI
VGVMSAGSSVKMPWLDKLQGLLHGYLTGQAGASAILDIITGKEIPTGKLSESYPFAYADC
SIVNYAGTEKRNLQYREGPFIGYRYYDTAEVAVQFPFGFGLSYTTFEYSALTVSENGVKF
TITNTGKRDGAEIAQIYVGKEQTGLIRPKKELKGFKKVWIKAGESVDVEIPFDDKTFRYF
STVSNKWEIEGGEYQIYVGASVVDIKLTGTISKAGTITELPYDIETLPSYKSGKVRNVHY
EEFEKLYAKPLVEEKVGPLDINDAFCQMKDAKSGLARLVYKFLKSKLDQSYEKGIPDLNI
MFIYNMPFRAMSKMTGGAVSREMTESIVTMVNGHFFRGLGGVIVGFFKNKRANKEYETKL
NNI

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.45

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	29	249	1.3e-65	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.93e-74	66	626	118	758	beta-glucosidase BglX.
COG1472	BglX	1.53e-62	30	352	55	374	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	2.29e-57	3	593	53	743	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	2.30e-36	313	503	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.61e-34	65	283	85	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK75766.1	0.0	1	783	1	783
QFJ55981.1	0.0	1	780	1	782
ADL34828.1	0.0	1	780	1	804
AOZ95741.1	0.0	1	780	1	804
QRT31068.1	0.0	1	780	1	807

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	2.05e-195	1	752	3	752	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	5.79e-179	7	643	9	673	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	1.80e-121	5	632	6	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	2.72e-120	5	632	6	712	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
3AC0_A	1.34e-97	2	625	5	828	Crystalstructure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_B Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_C Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus],3AC0_D Crystal structure of Beta-glucosidase from Kluyveromyces marxianus in complex with glucose [Kluyveromyces marxianus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P14002	5.62e-195	1	752	3	752	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
F6C6C1	2.59e-169	7	635	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium breve (strain ACS-071-V-Sch8b) OX=866777 GN=HMPREF9228_1477 PE=1 SV=1
E7CY69	2.27e-167	7	635	9	674	Exo-alpha-(1->6)-L-arabinopyranosidase OS=Bifidobacterium longum OX=216816 GN=apy PE=1 SV=1
A7LXS8	6.65e-122	4	630	47	742	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
Q5BFG8	5.45e-108	4	625	12	830	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000036	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002531_03193.