CAZyme Information: MGYG000002529_03323

Basic Information

• Species: Aeromonas veronii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas veronii
• CAZyme ID: MGYG000002529_03323
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
638	MGYG000002529_25|CGC1	69704.72	4.815

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002529	4703176	Isolate	China	Asia

• Gene Location: Start: 49983; End: 51899 Strand: +

Full Sequence      

MKKNRITLLLAGMMLSGHLWAAEAYDINKSYLGGSQVNYNGQVFEAKWWVNPGQTPGMAA
ANEWDTPWKLVGEGEVNPPDTGGDDKPNPPTPTPPDGSTTPVYMSQAELDAKEKALTDFP
AMEAVKASIATRDNLVVEAVQPGRADNPGNVKRVESLLSEGQFNYLFPLRASEYTYRGLL
QAAAKFPALCSDYSDGRDADAICRKTLATMFAHFAQETGGHENWRPEAEWRQALVYVREM
GWNETMRGGYNAECRPDVWQGQQWPCGTFDNGEFKSYFGRGAKQLSYNYNYGPFSEAMFG
TVRTLLDRPDLVADTWLNLASAVFFYTYPQPPKPSMLHVIDGTWQPNDHDKQNGLVPGFG
VTTQIINGGVECGGPVEHAQSQNRINYYREFANYLGVAVPSDEVLGCKNMKVFDDNGAGA
LPIYWEQDWSYVAENPNGGKSYACKLVGYQTRFSAFKAGDYSRCVQHFYPEVVIEDNGGG
TNLPPVANITGPAQAEGGSKVTLSGQHSSDPEGKPLTYAWTIPAGASAPALDQVTLELTL
PKPASDTKLEIKLTVTDEGSLSRSATHSLLVKGEEGGVTPPDYPAYKEGTPYKAGERVSN
GGASYECKPHPYTGWCAGAAWAYEPGKGTAWSDAWIKL

Enzyme Prediction     

No EC number prediction in MGYG000002529_03323.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	150	407	4.9e-74	0.9956709956709957
CBM73	585	635	1.3e-21	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	8.78e-73	158	407	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	3.85e-40	174	407	25	232	Chitinase class I.
COG3979	COG3979	3.10e-26	105	292	15	181	Chitodextrinase [Carbohydrate transport and metabolism].
PRK13211	PRK13211	4.20e-15	495	638	337	477	N-acetylglucosamine-binding protein GbpA.
cd12215	ChiC_BD	8.25e-07	24	64	2	40	Chitin-binding domain of chitinase C. Chitin-binding domain of chitinase C (ChiC) of Streptomyces griseus and related proteins. Chitinase C is a family 19 chitinase, and consists of a N-terminal chitin binding domain and a C-terminal chitin-catalytic domain that effects degradation. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. ChiC contains the characteristic chitin-binding aromatic residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QHC09315.1	0.0	1	638	1	638
AEB48889.1	0.0	1	638	1	638
QMS75728.1	0.0	1	638	1	638
QLH68073.1	0.0	1	638	1	638
ANB54297.1	0.0	1	638	1	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BAA_A	3.32e-34	154	413	2	242	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]
1CNS_A	3.01e-33	154	413	2	242	CrystalStructure Of Chitinase At 1.91a Resolution [Hordeum vulgare],1CNS_B Crystal Structure Of Chitinase At 1.91a Resolution [Hordeum vulgare]
3CQL_A	1.06e-32	154	413	2	242	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
4DWX_A	1.82e-31	154	413	3	243	CrystalStructure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DWX_B Crystal Structure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DYG_A Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale],4DYG_B Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale]
4J0L_A	2.48e-31	154	413	3	243	CrystalStructure of a Family GH19 Chitinase (W72A/E67Q mutant) from rye seeds in complex with two (GlcNAc)4 molecules [Secale cereale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	2.17e-36	174	413	94	307	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P52403	2.27e-36	174	413	96	309	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P24091	3.57e-36	142	413	64	315	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1
P52405	1.51e-35	174	413	96	309	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
P08252	1.93e-35	156	413	82	320	Endochitinase A OS=Nicotiana tabacum OX=4097 GN=CHN48 PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000341	0.998828	0.000220	0.000220	0.000190	0.000167

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002529_03323.