CAZyme Information: MGYG000002527_01967

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_01967
• CAZy Family: GH23
• CAZyme Description: Membrane-bound lytic murein transglycosylase F

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
250	MGYG000002527_19|CGC1	26980.37	9.4934

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 9785; End: 10537 Strand: -

Full Sequence      

MKAWMLLGMMPLFSHAAPAQIPPPAEVVILTPETAVSSPVPTPRTVALTTAPLPSPEPAK
PVSRQIQVYKSVQKNGVIRYSDMMPEQGHYELLLFNDCYACDPASKVNWRTTGLFLYDYA
STIQAAAKAYQVEPALIRALIHAESAFNPLAVSRKGAMGLTQLMPATARELGVGNALLAE
QNIFGGVKYLAGLLKQYDGNVALATAAYNAGAGAVQKHGGIPPYAETRAYVERVKLLHQR
YKEMLSAKGL

Enzyme Prediction     

No EC number prediction in MGYG000002527_01967.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	130	238	3e-27	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00254	LT-like	3.16e-45	134	234	1	106	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd13401	Slt70-like	1.15e-42	114	234	1	142	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
cd16896	LT_Slt70-like	1.68e-39	117	240	2	146	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
pfam01464	SLT	2.75e-33	123	230	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
cd13403	MLTF-like	5.91e-29	123	242	1	160	membrane-bound lytic murein transglycosylase F (MLTF) and similar proteins. This subfamily includes membrane-bound lytic murein transglycosylase F (MltF, murein lyase F) that degrades murein glycan strands. It is responsible for catalyzing the release of 1,6-anhydromuropeptides from peptidoglycan. Lytic transglycosylase catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc) as do goose-type lysozymes. However, in addition, it also makes a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT67504.1	1.33e-173	1	250	1	250
SQH58808.1	1.33e-173	1	250	1	250
BBS16181.1	1.33e-173	1	250	1	250
BDA12764.1	3.81e-173	1	250	1	250
BCM76624.1	2.20e-172	1	250	1	250

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MPQ_A	3.96e-13	106	247	405	561	BulgecinA: The key to a broad-spectrum inhibitor that targets lytic transglycosylases [Neisseria meningitidis]
5O1J_A	3.97e-13	106	247	409	565	Lytictransglycosylase in action [Neisseria meningitidis MC58]
6FPN_B	3.98e-13	106	247	415	571	Lytictransglycosylase in action [Neisseria meningitidis MC58]
5O24_A	3.99e-13	106	247	419	575	Lytictransglycosylase in action [Neisseria meningitidis]
5O29_A	4.01e-13	106	247	425	581	Lytictransglycosylase in action [Neisseria meningitidis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31608	2.54e-34	106	234	49	175	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1
O64046	1.11e-31	111	234	1414	1537	Probable tape measure protein OS=Bacillus phage SPbeta OX=66797 GN=yomI PE=3 SV=1
O31976	1.11e-31	111	234	1414	1537	SPbeta prophage-derived uncharacterized transglycosylase YomI OS=Bacillus subtilis (strain 168) OX=224308 GN=yomI PE=3 SV=2
P27380	4.30e-14	122	234	10	115	Transglycosylase OS=Enterobacteria phage PRD1 OX=10658 GN=VII PE=1 SV=3
Q4ZX03	2.42e-10	72	213	250	389	Membrane-bound lytic murein transglycosylase F OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=mltF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000632	0.998517	0.000227	0.000234	0.000185	0.000171

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_01967.