CAZyme Information: MGYG000002527_00794

Basic Information

• Species: Aeromonas caviae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas caviae
• CAZyme ID: MGYG000002527_00794
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
366	MGYG000002527_8|CGC2	39986.39	9.175

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002527	4477475	Isolate	Brazil	South America

• Gene Location: Start: 79311; End: 80411 Strand: -

Full Sequence      

MPLFQTPPSSICILRLSAIGDCCHALALVRVIQREWPQTRITWITGKIEATLFADLPGVE
VIPFDKSKGWRGYRDLWQTLKGRRFDALLHLQAAMRASIATLGIKAKVKLGFDRVRASDG
QWLFTNHRVPSPASPHVLDGFLAFAKELGIKDLTPDWQLPISAEHQAWAKEKIGGKPTLL
ICAAASKAFKNWTAAGYAALADHAADKGFQVYLCGGPAKLERDLAAEIQRLSQSKPADLV
GQTSLKQLLALIGEASLVLAPDTGPAHMATLVGTPVIGLYAHHNPARTGPYLCRDYLVSV
YQELIEQETGKPLAELGWRTRLKDPDAMAKISRERVIAAFDRLCTDKHLLPTQGNSEIPS
PGAGII

Enzyme Prediction     

No EC number prediction in MGYG000002527_00794.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	75	295	2.9e-51	0.8711111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0859	RfaF	2.84e-77	10	342	3	334	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	8.58e-73	10	342	1	277	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
pfam01075	Glyco_transf_9	2.57e-54	74	313	2	243	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
PRK10422	PRK10422	3.45e-22	7	280	4	288	lipopolysaccharide core biosynthesis protein; Provisional
PRK10916	PRK10916	1.07e-09	190	347	195	346	ADP-heptose--LPS heptosyltransferase RfaF.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCM73478.1	1.13e-271	1	366	1	366
QDO73964.1	1.13e-271	1	366	1	366
QQA59400.1	7.61e-270	1	366	1	366
BDA11491.1	7.61e-270	1	366	1	366
QSO22044.1	1.08e-269	1	366	1	366

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57336	2.33e-117	1	343	1	344	Lipopolysaccharide core heptosyltransferase OpsX OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=opsX PE=3 SV=1
P25742	6.32e-14	20	280	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	8.27e-14	20	280	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002527_00794.