CAZyme Information: MGYG000002526_03024

Basic Information

• Species: Aeromonas hydrophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila
• CAZyme ID: MGYG000002526_03024
• CAZy Family: GH84
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
367	MGYG000002526_1|CGC32	41406.32	6.7312

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002526	5049466	Isolate	United States	North America

• Gene Location: Start: 3336643; End: 3337746 Strand: +

Full Sequence      

MPYQTLLSGLQPPSPQLGVIEGFFGKGWSWEARARYAQWLPRHGYGFYLYAPKEDGYLRK
HWAKPWPAAQLEALRQLARQCRDNGLAFGVGLSPMGAHHDYARQRPSLQEKVQLIEEELK
PDILAVLFDDMKGDTPDLAHWQLTIAHDIAAHTRAGRLLFCPSYYSTDPVLEKVFGAMPP
HYLQDLGQGLDKRFEIFWTGPKVCSSDYPAAHLKQVAEWLHRKPFLWDNYPVNDGSKASS
FLHLRAFENRPAELAELTSGHAVNPMKQAALSVLPLATLPMSYKLGKQYDPDKALHASLN
ATCGPQISAMIQADLPLFQDIGLAQLTPEQVAHLKARYLPFRDQSCVGEILRWLDGEYVF
DPDCLTD

Enzyme Prediction     

No EC number prediction in MGYG000002526_03024.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH84	18	309	9.9e-83	0.9694915254237289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07555	NAGidase	1.89e-59	18	306	2	285	beta-N-acetylglucosaminidase. This family has previously been described as a hyaluronidase. However, more recently it has been shown that this family has beta-N-acetylglucosaminidase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANT68635.1	1.98e-286	1	367	1	367
BCK64048.1	2.70e-284	1	367	1	367
QBX72227.1	7.74e-284	1	367	1	367
QBX76927.1	7.74e-284	1	367	1	367
AUZ75820.1	7.74e-284	1	367	1	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5DIY_A	3.70e-42	18	334	8	324	Thermobaculumterrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum],5DIY_B Thermobaculum terrenum O-GlcNAc hydrolase mutant - D120N [Thermobaculum terrenum]
2XSA_A	1.21e-38	18	301	4	290	ChainA, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516],2XSB_A Chain A, Hyaluronoglucosaminidase [Oceanicola granulosus HTCC2516]
7KHS_A	1.25e-38	18	301	6	292	ChainA, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_B Chain B, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_C Chain C, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516],7KHS_D Chain D, Protein O-GlcNAcase [Oceanicola granulosus HTCC2516]
5UHK_A	1.59e-26	18	284	8	278	Crystalstructure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHK_C Crystal structure of the core catalytic domain of Human O-GlcNAcase [Homo sapiens],5UHL_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHL_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with Thiamet G [Homo sapiens],5UHO_A Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens],5UHO_C Crystal structure of the core catalytic domain of human O-GlcNAcase complexed with PUGNAc [Homo sapiens]
5UHP_A	2.94e-26	18	284	51	321	Crystalstructure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_B Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_C Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],5UHP_D Crystal structure of the core catalytic domain of human O-GlcNAcase [Homo sapiens],6PM9_A Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_B Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_C Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens],6PM9_D Crystal structure of the core catalytic domain of human O-GlcNAcase bound to MK-8719 [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2CEE3	6.62e-38	18	301	4	290	Protein O-GlcNAcase OS=Oceanicola granulosus (strain ATCC BAA-861 / DSM 15982 / KCTC 12143 / HTCC2516) OX=314256 GN=OG2516_04129 PE=1 SV=1
O60502	1.00e-24	18	284	63	333	Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2
Q8VIJ5	1.00e-24	18	284	63	333	Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1
Q9EQQ9	1.00e-24	18	284	63	333	Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Oga PE=1 SV=2
Q89ZI2	1.00e-18	18	276	152	405	O-GlcNAcase BT_4395 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=BT_4395 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002526_03024.