CAZyme Information: MGYG000002526_02344

Basic Information

• Species: Aeromonas hydrophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila
• CAZyme ID: MGYG000002526_02344
• CAZy Family: GH102
• CAZyme Description: Membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
383	MGYG000002526_1|CGC22	42362.53	9.5451

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002526	5049466	Isolate	United States	North America

• Gene Location: Start: 2570742; End: 2571893 Strand: -

Full Sequence      

MNKHAYWLTAAVLGLAGCAGNSEQAQVPKNKPDARCFLNCEVPENLGKQYLDGPLPDDLV
RVERVNSRQRADYSKFGPQSRLVLERSGKMTRRYGELYHQLSRWVANGGDPAQITRYGIS
LAQLGGSDRMGNVLFTGYYSPVLEVRHRPDAKYKYPIYAMPKCGGRCPSRAQIHQGALAN
RGLELGYSKSLIDNFLMDVQGSGFVHYGDDDRLQYLGYSGKNGHGYVSIGRVLIDRGEVP
KEQMSMKAIKEWAKRQPEESVKELVEQNPSYVFFERRPTNDVIGAAGIPLLPMAAVAADK
TLLPMGTPILAEVPLLDKEGNWTGKHQLRLLIALDVGGAVKKGHLDLYHGMGEKAGVAAG
HYKHFGRVWKLGLHHGPTAAPWL

Enzyme Prediction     

No EC number prediction in MGYG000002526_02344.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH102	144	275	5.9e-40	0.9872611464968153

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11162	mltA	0.0	6	372	8	355	murein transglycosylase A; Provisional
COG2821	MltA	2.63e-128	41	381	29	373	Membrane-bound lytic murein transglycosylase [Cell wall/membrane/envelope biogenesis].
smart00925	MltA	5.63e-63	142	274	1	152	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
pfam03562	MltA	3.13e-52	134	274	67	230	MltA specific insert domain. This beta barrel domain is found inserted in the MltA a murein degrading transglycosylase enzyme. This domain may be involved in peptidoglycan binding.
cd14668	mlta_B	9.83e-52	143	277	1	159	Domain B insert of mltA_like lytic transglycosylases. Escherichia coli MltA is a membrane-bound lytic transglycosylase comprised of two domains separated by a large groove, where the peptidoglycan strand binds. Domain A is made up of an N-terminal and a C-terminal portion, which correspond to the 3D domain, named for 3 conserved aspartate residues. Domain B is inserted within the linear sequence of domain A. MltA is distinct from other bacterial lytic transglycosylases (LTs), which are similar to each other. Escherichia coli peptidoglycan lytic transglycosylase (LT) initiates cell wall recycling in response to damage, during bacterial fission, and cleaves peptidoglycan (PG) to create functional spaces in its wall. PG chains (also known as murein), the major components of the bacterial cell wall, are comprised of alternating beta-1-4-linked N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), and lytic transglycosylases cleave this beta-1-4 bond. Typically, peptidoglycan lytic transglycosylases (LT) are exolytic, releasing Metabolite 1 (GlcNAc-anhMurNAc-L-Ala-D-Glu-m-Dap-D-Ala-D-Ala) from the ends of the PG strands. In contrast, MltE is endolytic , cleaving in the middle of PG strands, with further processing to Metabolite 1 accomplished by other LTs. In E. coli, there are six membrane-bound LTs: MltA-MltF and soluble Slt70. Slt35 is a soluble fragment cleaved from MltB. Bacterial LTs are classified in 4 families: Family 1 includes slt70 MltC-MltF, Family 2 includes MltA, Family 3 includes MltB, and Family 4 of bacteriophage origin. While most of the LT family members are similar in structure and sequence with a lysozyme-like fold, Family 2 (including mltA) is distinct.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANT68037.1	6.48e-291	1	383	1	383
QBX71306.1	3.75e-290	1	383	1	383
ABK36561.1	3.75e-290	1	383	1	383
ALZ80262.1	3.75e-290	1	383	1	383
ALQ63591.1	3.75e-290	1	383	1	383

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2GAE_A	8.65e-104	43	371	6	334	Crystalstructure of MltA from E. coli [Escherichia coli]
2AE0_X	1.35e-102	43	371	5	333	Crystalstructure of MltA from Escherichia coli reveals a unique lytic transglycosylase fold [Escherichia coli]
2PJJ_A	2.18e-101	43	371	5	333	ChainA, Membrane-bound lytic murein transglycosylase A [Escherichia coli K-12]
2PIC_A	4.37e-101	43	371	5	333	ChainA, Membrane-bound lytic murein transglycosylase A [Escherichia coli K-12]
2PI8_A	5.86e-96	43	371	5	333	Crystalstructure of E. coli MltA with bound chitohexaose [Escherichia coli K-12],2PI8_B Crystal structure of E. coli MltA with bound chitohexaose [Escherichia coli K-12],2PI8_C Crystal structure of E. coli MltA with bound chitohexaose [Escherichia coli K-12],2PI8_D Crystal structure of E. coli MltA with bound chitohexaose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9KPQ4	2.07e-152	34	382	12	360	Membrane-bound lytic murein transglycosylase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mltA PE=3 SV=1
P0A935	8.75e-103	43	371	25	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli (strain K12) OX=83333 GN=mltA PE=1 SV=1
P0A936	8.75e-103	43	371	25	353	Membrane-bound lytic murein transglycosylase A OS=Escherichia coli O157:H7 OX=83334 GN=mltA PE=3 SV=1
P57531	1.08e-79	45	371	28	356	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mltA PE=3 SV=1
Q8K9A7	1.04e-75	45	371	36	364	Membrane-bound lytic murein transglycosylase A homolog OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) OX=198804 GN=mltA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000049	1.000004	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002526_02344.