CAZyme Information: MGYG000002526_01015

Basic Information

• Species: Aeromonas hydrophila
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Aeromonadaceae; Aeromonas; Aeromonas hydrophila
• CAZyme ID: MGYG000002526_01015
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640	MGYG000002526_1|CGC13	68816.71	5.0499

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002526	5049466	Isolate	United States	North America

• Gene Location: Start: 1032285; End: 1034207 Strand: +

Full Sequence      

MMTRKSSVATLLAGLCLSGQLWAASAYDINQGYGGGSQVSFNGQIYEAKWYANPGQSPGV
QVANEWDSPWALLGAGEATPPGDGEGIAPPAQGGSGAADGSTVYLSQSELDAKEHALTDF
PAMTAVKASIATRDNAVVEAVAPGLPLNPANVKRVEGLISESQFNFLFPLRAPEYTYRGF
LQAVAKFPAFCGDYSDGRNAEAICRKSLATMFAHFAQETGGHESWRPEPEWRQGLVWVRE
MGWTEQMRGGYNAECRPDVWQGQQWPCGKFDNGEFKSYFGRGAKQLSYNYNYGPFSEAMF
GTVRTLLDNPEKVADTWLNLASAVFFFVYPQPPKPSMLHVIDGTWQPNAHDRQNGLVPGF
GVTTQIINGGVECGGAAEHAQSQNRITYYQAQAQYLGVPVPADEVLGCKNMKYFDEAGAG
ALPIYWENDWSYVPGNPNGGKSYACKLVGYQTRFSAFKERDYSRCVQHFFPEVVIEDNGG
GTNLPPVASISGPSEALGGATVLLSGQGSSDPEGKPLSYAWTLPAGASASDLTQSTLSAI
LPPTPTSDTRYGFVLKVTDDKGLSRSATHEILIKGSGGTTPPDGNPPYKEGTAYKAGDKV
SNLGGNYQCKPHPYTGWCAGAAWAYEPGKGTAWSDAWIKL

Enzyme Prediction     

No EC number prediction in MGYG000002526_01015.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	151	408	6.9e-76	0.9956709956709957
CBM73	588	637	1.3e-22	0.9259259259259259

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	1.41e-73	159	408	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	3.27e-39	158	399	1	225	Chitinase class I.
COG3979	COG3979	4.83e-25	105	293	14	181	Chitodextrinase [Carbohydrate transport and metabolism].
PRK13211	PRK13211	5.97e-15	524	640	354	477	N-acetylglucosamine-binding protein GbpA.
cd12214	ChiA1_BD	9.57e-06	587	625	1	41	chitin-binding domain of Chi A1-like proteins. This group contains proteins related to the chitin binding domain of chitinase A1 (ChiA1) of Bacillus circulans WL-12. Glycosidase ChiA1 hydrolyzes chitin and is comprised of several domains: the C-terminal chitin binding domain, an N-terminal and catalytic domain, and 2 fibronectin type III-like domains. Chitinases function in invertebrates in the degradation of old exoskeletons, in fungi to utilize chitin in cell walls, and in bacteria which use chitin as an energy source. Bacillus circulans WL-12 ChiA1 facilitates invasion of fungal cell walls. The ChiAi chitin binding domain is required for the specific recognition of insoluble chitin. although topologically and structurally related, ChiA1 lacks the characteristic aromatic residues of Erwinia chrysanthemi endoglucanase Z (CBD(EGZ)).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANT66866.1	0.0	1	640	1	640
ABK38513.1	0.0	1	640	60	699
BCO15116.1	0.0	1	640	1	640
QSR69836.1	0.0	1	640	60	699
QSR65605.1	0.0	1	640	60	699

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BAA_A	6.31e-34	155	398	2	228	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]
1CNS_A	1.07e-32	155	398	2	228	CrystalStructure Of Chitinase At 1.91a Resolution [Hordeum vulgare],1CNS_B Crystal Structure Of Chitinase At 1.91a Resolution [Hordeum vulgare]
3CQL_A	1.31e-31	155	414	2	242	CrystalStructure of GH family 19 chitinase from Carica papaya [Carica papaya],3CQL_B Crystal Structure of GH family 19 chitinase from Carica papaya [Carica papaya]
4DWX_A	3.42e-31	155	414	3	243	CrystalStructure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DWX_B Crystal Structure of a Family GH-19 Chitinase from rye seeds [Secale cereale],4DYG_A Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale],4DYG_B Crystal Structure of a Family GH-19 Chitinase from rye seeds in complex with (GlcNAc)4 [Secale cereale]
4J0L_A	4.68e-31	155	414	3	243	CrystalStructure of a Family GH19 Chitinase (W72A/E67Q mutant) from rye seeds in complex with two (GlcNAc)4 molecules [Secale cereale]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P08252	1.73e-37	146	414	71	320	Endochitinase A OS=Nicotiana tabacum OX=4097 GN=CHN48 PE=1 SV=2
P24091	2.90e-37	143	414	64	315	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1
P52404	2.20e-36	157	414	68	307	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P52403	3.16e-36	146	414	59	309	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P52405	2.10e-35	146	414	59	309	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000316	0.998786	0.000251	0.000250	0.000200	0.000181

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002526_01015.