CAZyme Information: MGYG000002521_03937

Basic Information

• Species: Phytobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter ursingii
• CAZyme ID: MGYG000002521_03937
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
210		22980	9.8831

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002521	6166452	Isolate	United States	North America

• Gene Location: Start: 3302340; End: 3302972 Strand: -

Full Sequence      

MTKDQFTRATGISASLADKWYPHIIKVMDEFGINTPLREAHFLAQIGAESNGWRSVVESL
NYSVAGLLIFGDRLTAAQREKLGRKPGELALSPARQADIANIVYGGRYGNTQPGDGWKYR
GRGLKQVTFRANYDACGKALGLDLVNNPDLLLLDQNAARSAGWFWSVNNCNSFADKDDIV
GLTKRINGGTNGLDDRKARYSVAKSVLVGK

Enzyme Prediction     

No EC number prediction in MGYG000002521_03937.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	29	172	1.3e-33	0.47186147186147187

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3179	COG3179	8.37e-69	1	209	4	206	Predicted chitinase [General function prediction only].
pfam00182	Glyco_hydro_19	2.09e-11	112	181	102	170	Chitinase class I.
cd00325	chitinase_GH19	2.91e-09	113	189	97	189	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL13283.1	1.16e-154	1	210	1	210
QOV59898.1	1.22e-115	1	210	1	210
QGU87068.1	1.23e-108	1	207	1	207
QBM22323.1	4.67e-108	1	207	1	207
ADZ13641.1	5.44e-107	1	208	1	208

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4OK7_A	1.88e-64	1	207	16	222	ChainA, Endolysin [Salmonella phage SPN1S],4OK7_B Chain B, Endolysin [Salmonella phage SPN1S],4OK7_C Chain C, Endolysin [Salmonella phage SPN1S]
4IJ4_A	6.91e-11	116	189	90	166	CrystalStructure of a Family GH19 chitinase from Bryum coronatum in complex with (GlcNAc)4 [Gemmabryum coronatum]
3WH1_A	7.00e-11	116	189	91	167	CrystalStructure of a Family GH19 Chitinase from Bryum coronatum in complex with (GlcNAc)4 at 1.0 A resolution [Gemmabryum coronatum]
7F88_A	1.18e-10	118	189	84	158	ChainA, Chitinase A [Gemmabryum coronatum],7F88_B Chain B, Chitinase A [Gemmabryum coronatum],7F88_C Chain C, Chitinase A [Gemmabryum coronatum]
4MST_A	5.12e-10	116	165	105	155	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P44187	6.69e-28	12	200	5	191	Glycosyl hydrolase family 19 domain-containing protein HI_1415 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1415 PE=3 SV=1
O64203	1.07e-13	8	206	187	360	Endolysin A OS=Mycobacterium phage D29 OX=28369 GN=10 PE=1 SV=1
Q41596	3.85e-10	116	181	178	244	Endochitinase 1 OS=Theobroma cacao OX=3641 GN=CHIA1 PE=2 SV=1
P52404	1.29e-09	116	209	173	265	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
Q7DNA1	3.49e-09	116	198	195	300	Chitinase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=Cht2 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999703	0.000301	0.000003	0.000000	0.000000	0.000003

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002521_03937.