CAZyme Information: MGYG000002521_02031

Basic Information

• Species: Phytobacter ursingii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Phytobacter; Phytobacter ursingii
• CAZyme ID: MGYG000002521_02031
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
679	MGYG000002521_5|CGC23	77875.16	6.0712

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002521	6166452	Isolate	United States	North America

• Gene Location: Start: 1342821; End: 1344860 Strand: -

Full Sequence      

MSELIQHPDSIEWRFERQILRIEAWGEHSLRVRATCAPTFSDNPHALLPPQTCEPQITAG
AEQLTLRNGNITAVLNLKGQLAFYNQRGELLLEEMWRQRSTVGIGASEKSQDKYISALKL
DGREFKPLPGGKYQLTVRFESRPEERIYGMGQYQQPWLDLKGCALELAQRNSQASVPFMQ
SSLGYGLLWNNPAIGEANFAKNQTIWLARVTQEMDYWITAADSVQQLTRQYAKATGTPPP
APAFTSGLWQCKLRYRTQQEVLEVAREYRRRHLPLSVMVIDFFHWPNQGTWCFDPVDWPD
PKAMVDELKSMGIELMVSVWPTVEARSPLFPVMKARGLLVTSDRGVQVNLDFMGNTTFFD
ATHPQARAFVWETVKKNYYDLGIKLFWLDEAEPEYRAYDFDNYRYHAGPVLEVGNQYPRD
FAQGFYDGLQTCGEREIINLVRCAWAGSQRFGVLAWSGDVHSSFHAFRNQLAAGLNMGLS
GIPWWTTDIGGFQGGNVNDPAFHELLIRWFQWAVFCPVLRMHGYREPQIQPPESYRNGIP
QCNSGSPNELWSYGEENYAIMQHWLSVREKLRPYVDALFANAHQHGDPLMRPLFWHYPDE
PQSWQVEDQYLFGEDILVAPILHAGQRQREVWLPGNHGWVALNGERYQGQQRMTVDAGLE
TIPVFIREGSKTTGMLPDA

Enzyme Prediction     

No EC number prediction in MGYG000002521_02031.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	216	670	3.2e-136	0.9929742388758782

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1501	YicI	1.71e-173	63	670	84	668	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
cd06591	GH31_xylosidase_XylS	2.61e-166	236	568	1	322	xylosidase XylS-like. XylS is a glycosyl hydrolase family 31 (GH31) alpha-xylosidase found in prokaryotes, eukaryotes, and archaea, that catalyzes the release of alpha-xylose from the non-reducing terminal side of the alpha-xyloside substrate. XylS has been characterized in Sulfolobus solfataricus where it hydrolyzes isoprimeverose, the p-nitrophenyl-beta derivative of isoprimeverose, and xyloglucan oligosaccharides, and has transxylosidic activity. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The XylS family corresponds to subgroup 3 in the Ernst et al classification of GH31 enzymes.
pfam01055	Glyco_hydro_31	1.01e-140	222	670	6	440	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd06603	GH31_GANC_GANAB_alpha	2.86e-62	236	670	1	424	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.
PRK10426	PRK10426	2.32e-61	49	671	5	622	alpha-glucosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AKL11590.1	0.0	1	679	1	679
AUV00859.1	0.0	1	676	1	676
QJF17311.1	0.0	1	676	1	676
QOV67040.1	0.0	1	676	1	676
AUU91559.1	0.0	1	676	1	676

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6DRU_A	3.83e-102	58	665	68	704	Xylosidasefrom Aspergillus niger [Aspergillus niger],6DRU_B Xylosidase from Aspergillus niger [Aspergillus niger]
7KMP_A	1.09e-82	20	670	79	863	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]
5JOU_A	3.63e-76	18	670	47	842	Bacteroidesovatus Xyloglucan PUL GH31 [Bacteroides ovatus],5JOV_A Bacteroides ovatus Xyloglucan PUL GH31 with bound 5FIdoF [Bacteroides ovatus]
2XVG_A	1.23e-70	20	670	68	872	crystalstructure of alpha-xylosidase (GH31) from Cellvibrio japonicus [Cellvibrio japonicus],2XVK_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with 5-fluoro-alpha-D-xylopyranosyl fluoride [Cellvibrio japonicus],2XVL_A crystal structure of alpha-xylosidase (GH31) from Cellvibrio japonicus in complex with Pentaerythritol propoxylate (5 4 PO OH) [Cellvibrio japonicus]
6JR6_A	1.82e-64	112	670	124	686	Flavobacteriumjohnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR6_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A [Flavobacterium johnsoniae UW101],6JR7_A Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_B Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_C Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101],6JR7_D Flavobacterium johnsoniae GH31 dextranase, FjDex31A, complexed with glucose [Flavobacterium johnsoniae UW101]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q01336	0.0	1	529	1	529	Uncharacterized family 31 glucosidase ORF2 (Fragment) OS=Pseudescherichia vulneris OX=566 PE=3 SV=1
Q9P999	1.99e-112	133	670	100	620	Alpha-xylosidase OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=xylS PE=1 SV=1
A2QTU5	3.23e-101	58	665	86	722	Alpha-xylosidase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=axlA PE=1 SV=1
A7LXT0	1.96e-75	18	670	46	841	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1
Q5AW25	5.41e-58	145	672	178	696	Alpha-xylosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=agdD PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002521_02031.