CAZyme Information: MGYG000002519_03383

Basic Information

• Species: Enterobacter asburiae_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter asburiae_B
• CAZyme ID: MGYG000002519_03383
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
791	MGYG000002519_47|CGC1	85815.34	5.1538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002519	4770654	Isolate	France	Europe

• Gene Location: Start: 20607; End: 22982 Strand: +

Full Sequence      

MTTIYKDAGRPVHERVADLLARMTPEEKFAQMHAYWLILDENGNHRERSDLSDEFAGVSE
QAALSERLKLGVGQITRPLGTHIVDAKTGVRAANRLQRMMMEETRLGIPALFHEECLVGL
LCKDATLFPSSLNYGSTWDPELVQRAAEQIGKEARSVGCQQGLAPVLDVSRDVRWGRTEE
TFGEDPWLVGVMATAYVKGLQGDKRDLLATLKHYVGHSFSEGARNHAPVHLGFSELNDTF
LLPFEMAVKLANAGSVMPAYHDIDNQPGHSDSFLLTTVLREQWGFDGIIVADYGGVSLLH
QHHGISHDAAESAALAFNAGLDVELPKDDCARHLAEAVERGLIAMAKVDEIVARTLTEKF
RLGLFEKPYADENGIDLQNDMTRQAAREVATKSLTLLENNGILPLGGKPRVAVVGPTADD
PLALLSGYSFPVHLIISDMVEETSQVTTPRAALEQYLGTSNVRYAKGCHIIEKRMAGAPV
FPGDSGGKPMQQSPVSQSTAPIPEAVNAAQESDVVVACVGDLAGLFQSGTVGEGSDTDSL
NLPGVQQQLLEALVATGKPVIVVMTGGRPYNLQGLEDKVAALMMAWAPGQEGGWAIADVL
TGRAEPQGRLVVSVPKSAGAMPYYYNHKLKSGGTPFAFHFGSRYPFGFGLGWTTFSWGAV
RVAESSVPVDGEVRLSVDITNTGERSGSEVVQVYVRDKVATQVRPLQELKAFQRVTLSPG
ETATLTFTLPVEMFNFTRRDGKRIVEPGEFELQVGASSADIRETVMVNATGETRVLPAEW
RMLSTCEVQRA

Enzyme Prediction     

EC	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	102	326	1.5e-64	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.06e-160	16	763	38	759	beta-glucosidase BglX.
COG1472	BglX	1.03e-83	83	470	33	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.19e-77	24	357	1	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	6.89e-65	105	755	78	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	7.12e-54	394	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB04775.1	0.0	1	791	1	791
QYD28692.1	0.0	1	791	1	791
BBW45587.1	0.0	1	791	1	791
QYH16755.1	0.0	1	791	1	791
BBZ87282.1	0.0	1	791	1	791

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	2.58e-133	91	764	106	780	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5XXL_A	2.24e-126	89	762	65	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.22e-125	89	762	65	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z9S_A	1.57e-120	2	769	14	788	Functionaland Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum],5Z9S_B Functional and Structural Characterization of a beta-Glucosidase Involved in Saponin Metabolism from Intestinal Bacteria [Bifidobacterium longum]
5YOT_A	1.03e-114	5	762	7	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.05e-123	105	765	62	718	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	8.70e-118	16	763	38	759	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	1.71e-117	16	763	38	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	9.06e-107	5	764	29	750	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	2.00e-84	12	761	35	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002519_03383.