CAZyme Information: MGYG000002519_00916

Basic Information

• Species: Enterobacter asburiae_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter asburiae_B
• CAZyme ID: MGYG000002519_00916
• CAZy Family: GH19
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
609	MGYG000002519_9|CGC1	66455.87	4.6601

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002519	4770654	Isolate	France	Europe

• Gene Location: Start: 50570; End: 52399 Strand: -

Full Sequence      

MNKRTLLSVLIAGACVAPFMAQATQLQASSEPYTVKASDLQKKEQELTNFPLMASVKSTI
RTLDNSLVEQIEPGKSTNPENVKRVEGIIKASDWEYLFPLRAPEYTYSNFLKAVGKFPAL
CQTYTDGRNSDAICRKSLATMFAHFAQETGGHESWRPEAEWRQALVYVREMGWSEGQKGG
YNGECNPDVWQGQTWPCGKDKDGDFVSYFGRGAKQLSYNYNYGPFSEAMYGDVRVLLDKP
ELVADTWLNLASAIFFFAYPQPPKPSMLQVIDGTWQPNDHDKANGLVPGFGVTTQIINGG
VECGGPTEIAQSQNRIKYYKEFANYLKVPVPSNEVLGCANMKQFDEGGAGALKIYWEQDW
GWSADTPSGQTYSCQLVGYQTPFSAFKEGDYTKCVKHYFNVNVVGEDGTSDGGSVTPAPT
PTPVDPTDEGNTTPVPDDNTPAPEDNTPAPVNHAPVAKIAGPVGAVEAGKSVSLNASGST
DEDGNHLTYTWTAPNGQTVSGDDKAIITFNAPEVAAATQYPINLTVSDGELSSTTTYTLN
VQAKQTNGGQTGTYPTWTSKTKWKAGDIVNNRGQLFQCKPYPYSGWCNNAPSYYEPGKGI
AWQDAWTAL

Enzyme Prediction     

No EC number prediction in MGYG000002519_00916.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH19	81	338	3.1e-77	0.9956709956709957
CBM73	557	607	1.9e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00325	chitinase_GH19	4.55e-72	89	338	1	224	Glycoside hydrolase family 19, chitinase domain. Chitinases are enzymes that catalyze the hydrolysis of the beta-1,4-N-acetyl-D-glucosamine linkages in chitin polymers. Glycoside hydrolase family 19 chitinases are found primarily in plants (classes I, III, and IV), but some are found in bacteria. Class I and II chitinases are similar in their catalytic domains. Class I chitinases have an N-terminal cysteine-rich, chitin-binding domain which is separated from the catalytic domain by a proline and glycine-rich hinge region. Class II chitinases lack both the chitin-binding domain and the hinge region. Class IV chitinases are similar to class I chitinases, but they are smaller in size due to certain deletions. Despite lacking any significant sequence homology with lysozymes, structural analysis reveals that family 19 chitinases, together with family 46 chitosanases, are similar to several lysozymes including those from T4-phage and from goose. The structures reveal that the different enzyme groups arose from a common ancestor glycohydrolase antecedent to the prokaryotic/eukaryotic divergence.
pfam00182	Glyco_hydro_19	9.91e-40	105	333	25	229	Chitinase class I.
COG3979	COG3979	1.05e-31	22	223	1	181	Chitodextrinase [Carbohydrate transport and metabolism].
PRK13211	PRK13211	1.02e-09	525	609	388	477	N-acetylglucosamine-binding protein GbpA.
pfam18911	PKD_4	4.40e-08	451	529	8	80	PKD domain. This entry is composed of PKD domains found in bacterial surface proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QYD28263.1	0.0	1	609	1	609
BCT18209.1	0.0	1	609	1	609
AUM02942.1	0.0	1	609	1	609
QVK35146.1	0.0	1	609	1	609
QBB04372.1	0.0	1	609	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7V92_A	6.35e-36	105	347	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V92_B Chain B, GH19 Chitinase [Ficus microcarpa],7V92_C Chain C, GH19 Chitinase [Ficus microcarpa],7V92_D Chain D, GH19 Chitinase [Ficus microcarpa]
7V91_A	1.11e-34	105	347	29	245	ChainA, GH19 Chitinase [Ficus microcarpa],7V91_B Chain B, GH19 Chitinase [Ficus microcarpa],7V91_C Chain C, GH19 Chitinase [Ficus microcarpa],7V91_D Chain D, GH19 Chitinase [Ficus microcarpa]
2BAA_A	9.73e-34	105	344	29	242	TheRefined Crystal Structure Of An Endochitinase From Hordeum Vulgare L. Seeds To 1.8 Angstroms Resolution [Hordeum vulgare]
4MST_A	1.30e-33	105	347	26	242	CrystalStructure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis],4MST_B Crystal Structure of a putative catalytic domain of a chitinase-like protein (HbCLP1) from Hevea brasiliensis [Hevea brasiliensis]
1CNS_A	8.90e-33	105	344	29	242	CrystalStructure Of Chitinase At 1.91a Resolution [Hordeum vulgare],1CNS_B Crystal Structure Of Chitinase At 1.91a Resolution [Hordeum vulgare]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P52404	7.45e-39	105	347	94	310	Endochitinase 2 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB2 PE=2 SV=1
P52403	1.48e-38	105	347	96	312	Endochitinase 1 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB1 PE=2 SV=1
P52405	1.01e-37	105	347	96	312	Endochitinase 3 (Fragment) OS=Solanum tuberosum OX=4113 GN=CHTB3 PE=2 SV=1
P24091	1.59e-37	105	347	102	318	Endochitinase B OS=Nicotiana tabacum OX=4097 GN=CHN50 PE=1 SV=1
Q05538	2.88e-37	105	347	100	316	Basic 30 kDa endochitinase OS=Solanum lycopersicum OX=4081 GN=CHI9 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000845	0.927415	0.070558	0.000566	0.000329	0.000246

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002519_00916.