CAZyme Information: MGYG000002516_00770

Basic Information

• Species: Proteus vulgaris
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus vulgaris
• CAZyme ID: MGYG000002516_00770
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
728	MGYG000002516_1|CGC8	83897.52	6.0281

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002516	3639158	Isolate	Denmark	Europe

• Gene Location: Start: 806323; End: 808509 Strand: -

Full Sequence      

MSVAVTKKAIEKLINGYNSDPFALLGMHETSAGLEARAFLPDAVAVSVIDRKNGRKVATL
EFKHPSGFFCGVIPRRKRRFSYCLDVTWENNTQSVVDDPYQFGILLQEMDIWFLAQGHHS
RPYQCLGAHPTKLGDIDGITFAVWAPNAQSVSVVGDFSFWDERRFPMRLRRESGIWELFV
PQAHLGDCYKYAILDANGERRLKADPYAFETQIRPETASIINTLPSVKPMPLSRQHANQR
NAPISIYEVHLGSWRRHTDDQSWLSYRELAEQLIPYVKEMGFTHIELLPINEHPFDGSWG
YQPLGLYSPTRRFGSPMDFRDFIEAAHQAEISVILDWVPGHFPEDDYGLRNFDGTSLYEY
ADRREGFHPDWNTLIYNYGRNEVLNYLSGNLLYWHEHFALDGFRFDAVASMLYRDYSRKE
GEWIPNKHGGRENLEAIDFLRYTHKLLGATCPGIITIAEESTDFPGVTLPPDEGGLGFNY
KWNMGWMHDTLAYMQRDPIYRKFHHNQMTFGVLYAYNENFILPLSHDEFVHGKGSLIGRM
VGNDWQKFANLRAYLGFMWAYPGKKLLFMGCEFAQWREWNHDSSLDWHLLETPNSPHQGI
QHFVRDLNLSYQTNSPLYECDFEREGFEWLTVDDHDNSVFAFCRKDTQGNELIIISNFTP
VVHHNYVVGVNKAGIYQEIINSDSEFYNGTNVGNLGEIETTEKGLNGKPHSLSLTLPPLA
TLYLKLKD

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	275	575	4.8e-155	0.9966777408637874
CBM48	126	212	6e-20	0.9078947368421053

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	103	728	4	629	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	101	726	1	628	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	5	725	503	1221	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	121	725	22	620	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	5	728	1	725	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYY80613.1	0.0	1	728	1	728
QJW51014.1	0.0	1	728	1	727
QHD95617.1	0.0	1	728	1	727
QUT03489.1	0.0	1	728	1	727
QHP76496.1	0.0	1	728	1	727

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	1.80e-318	114	724	2	612	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	9.91e-317	119	724	2	607	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	4.07e-250	1	726	21	773	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR5_A	1.16e-249	1	726	21	773	Crystalstructure of branching enzyme W610A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	1.64e-249	1	726	21	773	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5PM06	0.0	1	724	1	723	1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=glgB PE=3 SV=1
Q83PV3	0.0	1	724	1	723	1,4-alpha-glucan branching enzyme GlgB OS=Shigella flexneri OX=623 GN=glgB PE=3 SV=1
Q6CZK0	0.0	8	724	6	721	1,4-alpha-glucan branching enzyme GlgB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=glgB PE=3 SV=1
Q664I2	0.0	1	724	1	723	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=glgB PE=3 SV=1
Q8FCR7	0.0	1	724	1	723	1,4-alpha-glucan branching enzyme GlgB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) OX=199310 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002516_00770.