CAZyme Information: MGYG000002514_02838

Basic Information

• Species: Proteus mirabilis
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus mirabilis
• CAZyme ID: MGYG000002514_02838
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
639	MGYG000002514_1|CGC24	72928.49	7.7114

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002514	4101538	Isolate	Sweden	Europe

• Gene Location: Start: 3010010; End: 3011929 Strand: +

Full Sequence      

MVKQKWSFVLAISTLCFSAWAQADSLSEQRTRYQEIKAAWDAKDTAQVEKLLPTLQDYPL
YPYLEYRQITDNLDVVAPAVVTEFVEKYPTLPPAKALPSLFVNELAKRQEWQNLLTFSPN
PPKPKAARCNYYYAKWATGDKQTAWVGAKEAWLNGTSMPSSCDPLFDEWQKAGNLSIELV
LERINLAIKSGNTGLATYLAKQLPMDYQTINDAIVELQDHPNLVARYATQLSPTDFTRNI
VQAAFSRWARKDADSARAQLDSIARAQKMTTAERQLMRDTVAWQYMPYATPEQAKWRDSV
IQDTASDTLRERRVRLALSQNQPAELALWLERLSPESKNKEEWRYWRAMVLQSQGKNSEA
QALLQELTQHRGFYPMVAAEKLGKPYVMVIDKAPSVSPTIPQQPEVQRVRELMYWQMDNL
ARTEWANYVATQPATTQSQLARYAFEQQWADLAVQATITGKMWNHLEERFPLAWQNEFER
YTKDKAIDRNYAMAIARQESAWNPQARSSAGATGLMQVMPKTAEFTVKQAGITGYASSAQ
LTDPVKNIEIGTAYLDSVYQRFNQNRILSSAAYNAGPARVDRWLSDANSQLDAIAFIESI
PFAETRGYVKNVLSFAVFYSYFAGEQQPVLTQTEWNSRY

Enzyme Prediction     

No EC number prediction in MGYG000002514_02838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	490	616	1.1e-29	0.7703703703703704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	1	639	4	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	2.64e-66	469	621	1	151	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	1.08e-43	342	632	2	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	1.11e-41	471	613	1	141	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	3.65e-35	493	614	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWR60445.1	0.0	1	639	1	639
QYH21099.1	0.0	1	639	1	639
ALE21269.1	0.0	1	639	1	639
CAR47237.1	0.0	1	639	1	639
AVA38999.1	0.0	1	639	1	639

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	1.55e-243	24	639	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	5.09e-242	24	639	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	9.55e-88	23	639	24	638	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	5.39e-86	28	639	1	610	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	9.59e-86	29	639	1	609	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0AGC3	1.66e-244	6	639	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	1.66e-244	6	639	9	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P39434	4.73e-239	6	639	9	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P44888	2.07e-72	295	639	254	593	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.69e-14	487	620	73	181	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.002161	0.780859	0.215841	0.000507	0.000328	0.000284

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002514_02838.