CAZyme Information: MGYG000002508_01089

Basic Information

• Species: Hafnia alvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia alvei
• CAZyme ID: MGYG000002508_01089
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
201	MGYG000002508_1|CGC8	22462.43	6.6896

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002508	4498956	Isolate	South Korea	Asia

• Gene Location: Start: 1163439; End: 1164044 Strand: -

Full Sequence      

MISILKHPSRFGIMLLLLFLAGCSSKHHYKKYDTHAYDDVIEDAADDYKVDPKLIAAIIQ
VESSFNPEAVSPSNAIGLMQLKASSGGCDAYRYKGKRGCPDDDDLLDPETNIDLGAAYIS
AIQHQQLNWIDDPVTRRYATEVAYANGAGALLRTFSSNRKTAIQMINQLSPEAFHWHVRQ
YHPAAQAPRYMAKVEQVYNSL

Enzyme Prediction     

No EC number prediction in MGYG000002508_01089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	49	199	1.7e-22	0.8074074074074075

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	1.28e-70	41	199	3	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	2.22e-65	14	201	7	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	6.21e-50	35	194	190	349	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	2.78e-22	44	164	4	112	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	6.76e-21	35	197	137	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV44059.1	1.16e-145	1	201	1	201
QIP55096.1	3.34e-145	1	201	1	201
ANC39195.1	3.34e-145	1	201	1	201
QBJ32430.1	3.34e-145	1	201	1	201
AIU72042.1	3.34e-145	1	201	1	201

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	5.59e-49	24	201	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
2Y8P_A	6.04e-49	50	201	35	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	1.72e-48	50	201	35	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.72e-48	50	201	35	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	1.72e-48	50	201	35	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7MKC3	1.20e-55	13	201	6	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=emtA PE=3 SV=2
A8AFS5	1.11e-53	16	201	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B5R901	4.47e-53	16	201	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1
Q8XGT6	4.47e-53	16	201	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhi OX=90370 GN=emtA PE=3 SV=1
C0Q334	4.47e-53	16	201	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000003	1.000050	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002508_01089.