CAZyme Information: MGYG000002508_00066

Basic Information

• Species: Hafnia alvei
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Hafnia; Hafnia alvei
• CAZyme ID: MGYG000002508_00066
• CAZy Family: GT73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
259		30015.85	8.8498

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002508	4498956	Isolate	South Korea	Asia

• Gene Location: Start: 64420; End: 65199 Strand: +

Full Sequence      

MNHPQYISKNDVDMLMKEKMHENAVIFLSGPTSVNTPISLLNKSDVIAVNGSARYLIENE
IKPFIYVLTDDRFLLQRNDDFKFFVKNSQHTIVNCDVFEKASLEDKQFLQENCHIMKMLY
KREKGGFFKKIKFKILSLRNKNILIDVPMSKRRRLVGFSLDISDGYCSCHTVAYAAIQIA
YSLRYTKIICSGLDLVDSCSRFYDKNGESSMPSELSRDLGKILPFFQFMKSNVKDIEIYN
LSNNTAIDYKIIPYLNMKE

Enzyme Prediction     

No EC number prediction in MGYG000002508_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT73	18	257	3.6e-89	0.9877551020408163

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR04437	WaaZ_KDO_III	6.87e-150	6	256	1	250	Kdo-III transferase WaaZ. Members of this family are WaaZ, or Kdo-III transferase. This enzyme, present in some strains of E. coli and its allies but not others, performs a non-stoichiometric addition of a third 3-deoxy-D-manno-oct-2-ulosonic acid (KDO-III) onto some fraction of KDO-II in the lipopolysaccharide (LPS) inner core. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK09822	PRK09822	9.86e-122	1	259	1	258	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWV43157.1	2.15e-188	1	259	1	259
AIU71158.1	2.15e-188	1	259	1	259
QBJ31482.1	4.33e-188	1	259	1	259
QIP54178.1	6.15e-188	1	259	1	259
ANC40029.1	2.21e-181	1	259	1	259

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P27241	3.94e-112	1	259	1	258	Lipopolysaccharide core biosynthesis protein RfaZ OS=Escherichia coli (strain K12) OX=83333 GN=rfaZ PE=4 SV=2
P26473	7.22e-107	1	259	1	258	Lipopolysaccharide core biosynthesis protein RfaZ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfaZ PE=4 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002508_00066.