CAZyme Information: MGYG000002507_02844

Basic Information

• Species: Escherichia albertii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Escherichia; Escherichia albertii
• CAZyme ID: MGYG000002507_02844
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
154	MGYG000002507_18|CGC1	17297.93	9.23

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002507	4965177	Isolate	Gambia	Africa

• Gene Location: Start: 12136; End: 12600 Strand: +

Full Sequence      

MKMKKIILSIILISNSCYASDCFEITGKAYNIDPLILKAIAWNESKNKNGIKSKINKNGT
YDIGIMQINSSHLDLLSKFNISEDDLLNDACINISVAGYILASNIKSRGNTWDAVGAYNA
GYFNTPNAVELRRQYAMKIYKTYTKLKNNEQIID

Enzyme Prediction     

No EC number prediction in MGYG000002507_02844.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	33	151	6.8e-19	0.8444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd13400	LT_IagB-like	2.37e-49	30	145	1	109	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
PRK15328	PRK15328	2.09e-33	15	151	15	147	type III secretion system invasion protein IagB.
PRK13722	PRK13722	3.90e-31	17	152	17	151	lytic transglycosylase; Provisional
pfam01464	SLT	9.07e-17	27	141	5	113	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.73e-11	19	135	139	254	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAC81851.1	4.17e-107	1	154	1	154
AOM48558.1	4.17e-107	1	154	1	154
CAI43885.1	4.17e-107	1	154	1	154
BBF62425.1	4.17e-107	1	154	1	154
AAL57531.1	4.17e-107	1	154	1	154

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	1.61e-55	21	106	2	87	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q00739	1.25e-32	3	152	1	151	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P47737	7.07e-32	3	152	1	151	X polypeptide OS=Escherichia coli (strain K12) OX=83333 GN=yubQ PE=3 SV=1
P17738	1.00e-31	3	152	1	151	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
P14499	2.00e-31	3	152	1	151	X polypeptide OS=Escherichia coli OX=562 GN=X PE=3 SV=1
E1WAC2	6.43e-28	7	147	6	143	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004294	0.980516	0.014101	0.000369	0.000343	0.000352

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002507_02844.