CAZyme Information: MGYG000002503_03087

Basic Information

• Species: Enterobacter ludwigii
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Enterobacter; Enterobacter ludwigii
• CAZyme ID: MGYG000002503_03087
• CAZy Family: GH23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
146	MGYG000002503_8|CGC1	16635.99	8.8491

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002503	4697885	Isolate	Australia	Oceania

• Gene Location: Start: 39738; End: 40178 Strand: -

Full Sequence      

MKRFLLLLLILSQSAVANCWDKAAHYYHVDPYLLYAIAQVESGMNPNAVGWNQDGSRDVG
LMQINSTHFSELQRQGIDENRLVTEPCTSIMVGASILSTMINVYGYNWEAVGAYNAGVKK
ENYSKRMNYARKVWAKYQEIKPRSSY

Enzyme Prediction     

No EC number prediction in MGYG000002503_03087.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	27	141	3.7e-25	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15328	PRK15328	3.61e-80	1	146	1	148	type III secretion system invasion protein IagB.
cd13400	LT_IagB-like	4.71e-54	27	138	1	108	Escherichia coli invasion protein IagB and similar proteins. Lytic transglycosylase-like protein, similar to Escherichia coli invasion protein IagB. IagB is encoded within a pathogenicity island in Salmonella enterica and has been shown to degrade polymeric peptidoglycan. IagB-like invasion proteins are implicated in the invasion of eukaryotic host cells by bacteria. Lytic transglycosylase (LT) catalyzes the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Members of this family resemble the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
pfam01464	SLT	2.99e-28	20	117	1	95	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
PRK13722	PRK13722	4.69e-26	18	141	21	146	lytic transglycosylase; Provisional
cd00254	LT-like	7.68e-17	31	138	1	111	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEW72887.1	7.35e-104	1	146	1	146
AOT42380.1	7.35e-104	1	146	1	146
QDE49524.1	7.35e-104	1	146	1	146
AVP01737.1	7.35e-104	1	146	1	146
QCU05354.1	7.35e-104	1	146	1	146

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XP8_A	4.14e-10	18	101	2	86	Structureof EtgA D60N mutant [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E1WAC2	1.21e-46	4	145	5	147	Invasion protein IagB OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=iagB PE=3 SV=1
P0CL15	1.21e-46	4	145	5	147	Invasion protein IagB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=iagB PE=3 SV=1
P43018	3.45e-46	4	145	5	147	Invasion protein IagB OS=Salmonella typhi OX=90370 GN=iagB PE=3 SV=1
Q07568	1.27e-34	1	140	1	141	Protein IpgF OS=Shigella flexneri OX=623 GN=ipgF PE=3 SV=1
Q55287	7.23e-34	1	140	1	141	Protein IpgF OS=Shigella sonnei OX=624 GN=ipgF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999130	0.000163	0.000148	0.000144	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002503_03087.