CAZyme Information: MGYG000002496_03316

Basic Information

• Species: Salmonella bongori
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Salmonella; Salmonella bongori
• CAZyme ID: MGYG000002496_03316
• CAZy Family: GT2
• CAZyme Description: Glucans biosynthesis glucosyltransferase H

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
847	MGYG000002496_19|CGC2	96928.28	8.9908

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002496	4572147	Isolate	Italy	Europe

• Gene Location: Start: 58521; End: 61064 Strand: -

Full Sequence      

MNKTTEYIDALLLSEREKAALPKTDIRAVHQALDAEHRTYSREDDSPQGSVKARLEQAWP
DSLAQGQLIKDDEGRDQLQAMPKATRSSMSPDPWRTNPVGRFWDRLRGRDVTPRYVSRLT
KEEQASEQKWRTVGTVRRYILLILTLAQTVVATWYMKTILPYQGWALINPMDMVGQDIWV
SFMQLLPYVLQTGILILFAVLFCWVSAGFWTALMGFLQLLIGRDKYSISASTVGDEPLNP
EHRTALIMPICNEDVSRVFAGLRATWESVKATGNAAHFDVYILSDSYNPDICVAEQKAWM
ELIAEVQGEGQIFYRRRRRRVKRKSGNIDDFCRRWGNQYSYMVVLDADSVMSGECLSGLV
RLMEANPNAGIIQSSPKASGMDTLYARCQQFATRVYGPLFTAGLHFWQLGESHYWGHNAI
IRVKPFIEHCALAPLPGEGSFAGSILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNL
LDELKRDRRWCHGNLMNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFMFLALSTALQVV
HALTEPQYFLQPRQLFPVWPQWRPELAIALFASTMVLLFLPKLLSIMLIWCKGTKEYGGF
WRVTLSLLLEVLFSVLLAPVRMLFHTVFVVSAFLGWEVVWNSPQRDDDSTPWGEAFMRHG
SQLLLGLVWAVGMAWLDLRFLFWLAPIVFSLILSPFVSVFSSRSTVGLRTKRWKLFLIPE
EYSPPQVLVDTDKYLEMNRRRILDDGFMHAVFNPSLNALATAMATARHRASKVLEIARDR
HVEQALNETPEKLNRDRRLVLLSDPVTMARLHYRVWNAPERYSSWVNHYQSLVLNPQALQ
GRLSSVG

Enzyme Prediction     

No EC number prediction in MGYG000002496_03316.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	246	428	6.7e-24	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2943	MdoH	0.0	55	830	1	734	Membrane glycosyltransferase [Cell wall/membrane/envelope biogenesis, Carbohydrate transport and metabolism].
PRK05454	PRK05454	0.0	72	716	1	599	glucans biosynthesis glucosyltransferase MdoH.
cd04191	Glucan_BSP_MdoH	2.27e-153	244	497	1	254	Glucan_BSP_MdoH catalyzes the elongation of beta-1,2 polyglucose chains of glucan. Periplasmic Glucan Biosynthesis protein MdoH is a glucosyltransferase that catalyzes the elongation of beta-1,2 polyglucose chains of glucan, requiring a beta-glucoside as a primer and UDP-glucose as a substrate. Glucans are composed of 5 to 10 units of glucose forming a highly branched structure, where beta-1,2-linked glucose constitutes a linear backbone to which branches are attached by beta-1,6 linkages. In Escherichia coli, glucans are located in the periplasmic space, functioning as regulator of osmolarity. It is synthesized at a maximum when cells are grown in a medium with low osmolarity. It has been shown to span the cytoplasmic membrane.
pfam00535	Glycos_transf_2	8.94e-12	247	426	3	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
pfam13632	Glyco_trans_2_3	1.71e-10	341	541	1	194	Glycosyl transferase family group 2. Members of this family of prokaryotic proteins include putative glucosyltransferases, which are involved in bacterial capsule biosynthesis.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQP73718.1	0.0	1	847	1	847
QGF77752.1	0.0	1	847	1	847
QXY85152.1	0.0	1	847	1	847
CCC30085.1	0.0	1	847	1	847
QVP35967.1	0.0	1	847	1	847

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q48PK6	0.0	6	847	13	852	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) OX=264730 GN=opgH PE=3 SV=1
Q6D6A7	0.0	1	832	1	847	Glucans biosynthesis glucosyltransferase H OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=mdoH PE=3 SV=1
Q4ZZH4	0.0	6	838	13	843	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas syringae pv. syringae (strain B728a) OX=205918 GN=opgH PE=3 SV=1
Q4KJM5	0.0	6	838	13	841	Glucans biosynthesis glucosyltransferase H OS=Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5) OX=220664 GN=opgH PE=3 SV=1
Q82SA8	0.0	1	840	1	840	Glucans biosynthesis glucosyltransferase H OS=Nitrosomonas europaea (strain ATCC 19718 / CIP 103999 / KCTC 2705 / NBRC 14298) OX=228410 GN=opgH PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
139	156
194	216
512	534
568	590
603	625
680	702