CAZyme Information: MGYG000002495_03190

Basic Information

• Species: Citrobacter europaeus
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Citrobacter; Citrobacter europaeus
• CAZyme ID: MGYG000002495_03190
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
203	MGYG000002495_1|CGC48	22215.54	9.2859

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002495	5258449	Isolate	United States	North America

• Gene Location: Start: 3399084; End: 3399695 Strand: +

Full Sequence      

MKLRWFAFLVVLLAGCSSKQDYKNPPWNAEVPVKRAMQWMPISEKAGAAWGVSPQLITAI
IAIESGGNPNAVSKSNAIGLMQLKASTSGRDVYRRMGWSGEPSTSELKNPERNISMGAAY
LSILETGPLAGIEDPQVMQYALVVSYANGAGALLRTFSSDRKKAINKINDLSPDEFIEHV
ADNHPAPQAPRYIWKLQQALDVM

Enzyme Prediction     

No EC number prediction in MGYG000002495_03190.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	38	196	1.1e-16	0.837037037037037

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15470	emtA	3.37e-157	1	203	1	203	membrane-bound lytic murein transglycosylase EmtA.
cd16893	LT_MltC_MltE	9.75e-83	41	199	1	160	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK11671	mltC	2.89e-59	34	199	187	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	1.72e-31	45	168	3	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	2.28e-29	1	201	93	296	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNM21544.1	4.05e-147	1	203	1	203
ALD74876.1	4.05e-147	1	203	1	203
QYO53177.1	4.05e-147	1	203	1	203
QGG14344.1	4.05e-147	1	203	1	203
QKE20059.1	4.05e-147	1	203	1	203

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3T36_A	4.26e-123	17	203	17	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
4HJY_A	1.36e-122	17	203	20	206	2.4A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJY_B 2.4 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_A 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12],4HJZ_B 1.9 A Crystal structure of E. coli MltE-E64Q with bound chitopentaose [Escherichia coli K-12]
2Y8P_A	5.14e-122	19	203	2	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
6GHY_A	1.47e-121	19	203	2	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.47e-121	19	203	2	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5PN08	1.62e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=emtA PE=3 SV=1
C0Q334	1.62e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi C (strain RKS4594) OX=476213 GN=emtA PE=3 SV=1
Q57NL3	1.62e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=emtA PE=3 SV=1
A9MVX1	1.62e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) OX=1016998 GN=emtA PE=3 SV=1
Q7CQE4	1.62e-138	1	203	1	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000056	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002495_03190.