CAZyme Information: MGYG000002492_02508

Basic Information

• Species: Agathobacter rectalis
• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae; Agathobacter; Agathobacter rectalis
• CAZyme ID: MGYG000002492_02508
• CAZy Family: CBM23
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
772	MGYG000002492_1|CGC31	85359.13	5.5725

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002492	3449685	Isolate	not provided	not provided

• Gene Location: Start: 2632347; End: 2634665 Strand: -

Full Sequence      

MKKKIIATLLSLAIVMSGSFSAFAADFSENSESTGVDSVTSMEESSESNKSAEELISDET
ISQDDIIGGSEIKDTASNQLDVENTGEAKDVEVQLNDGNSVDIMPSNSVEDEEINTESSV
KTYASDSESASQSIFVNKKNYGELSKSDEVDNYKFTLSSAGSVRIDFGKEYEDSNRGWTV
EVYNSNWEIIKRDEFRCGNSKTDSSSVLGLASGTYYLRIKGIRWEWTDTKYNFTLVYSAS
NSWEKEANNSFSTATKVNTNSVCYGSISNSDSTDIDYYKFSMANAGHIRIDFGKEYDSNA
DHGWNVILYNSEQEKYIEWTFNCGNSKTDSTCEYGLPKGTYYILIKPIDYDDTSVTYNFN
INFSSSAVWEKELNDDLATPNLMNVNTTYYGTTTSWNEDCYKFTLKKNGTVSIDFGKAYD
KDTSHGWDVRLYNTDREEVSKGDVYCGDTNIKSVISTDLVAGSYYLKVSPKAYDVSEVVY
NIKVTAKNEPAPAQSTVSAVSGLKIGGRAGDALRLNWNKNTSADGYIVEQYKSGSWTRIA
RIGSNSTVTYRVEKLSPSTKYNFRVKAFKLNGNAATYSSYKNISGITNPATISGLKIGGH
AADALRLNWTKNSKASGYIVEQYKGGKWTRIARIGENSTTTYRVEKLSASTTYKFRVQAF
GFDGKTALYGNYAYINGKTSPATVTGIRIGGTAKDALRVNWNKDSKASGYIVQQYKNGTW
VRIARIGNNNTTTYRVSGLKSGSTYIFRVQAFGYDGKTAIYGGFAMIPGTTK

Enzyme Prediction     

No EC number prediction in MGYG000002492_02508.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd00063	FN3	1.32e-07	681	752	1	77	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	3.55e-07	681	756	1	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.
cd00063	FN3	2.88e-06	498	572	2	81	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
cd00063	FN3	6.60e-06	589	665	1	82	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	8.20e-06	498	572	2	81	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR76485.1	2.95e-110	290	772	340	793
CBK95964.1	1.35e-47	471	771	228	529
CBL34359.1	3.59e-47	471	771	464	765
CBL33682.1	5.28e-44	477	772	866	1171
CBK82808.1	8.25e-29	500	768	513	786

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P50899	2.62e-09	492	751	699	963	Exoglucanase B OS=Cellulomonas fimi (strain ATCC 484 / DSM 20113 / JCM 1341 / NBRC 15513 / NCIMB 8980 / NCTC 7547) OX=590998 GN=cbhB PE=1 SV=1
Q23551	9.79e-09	613	751	3688	3832	Twitchin OS=Caenorhabditis elegans OX=6239 GN=unc-22 PE=1 SV=3
Q6NWW9	3.14e-08	513	751	889	1130	Fibronectin type III domain-containing protein 3B OS=Mus musculus OX=10090 GN=Fndc3b PE=1 SV=1
Q53EP0	1.23e-07	546	751	916	1127	Fibronectin type III domain-containing protein 3B OS=Homo sapiens OX=9606 GN=FNDC3B PE=1 SV=2
Q8WZ42	3.40e-07	508	758	26047	26304	Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000315	0.998910	0.000197	0.000201	0.000178	0.000156

TMHMM  Annotations     

start	end
5	27