CAZyme Information: MGYG000002491_04553

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_04553
• CAZy Family: CBM48
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
730	MGYG000002491_33|CGC1	83766.08	6.6765

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 17716; End: 19908 Strand: +

Full Sequence      

MSDYNEKSAISALLAGHCSDPFSVLGMHSTAAGLEVRALLPDATEVWVIEPKTGRKAGKL
ECLDSRGFFSGVLPRRKNAFRYQLAVTWHGQQNLIDDPYRFGPLLQELDAWLLAEGTHLR
PYETLGAHADIMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFVP
GAHNGQLYKFELIDAHGHLRVKSDPYAFEAQMRPETASLICGLPEKVEQPPARKQANQFD
APISIYEVHLGSWRRHTDNHFWLSYRELADRLVPYVKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTREDFRYFLHAAHAAGLNVILDWVPGHFPADDFALALFDGTALYEHS
DPREGYHQDWNTLIYNYGRREVSNFLVGNALYWIERFGIDALRVDAVASMIYRDYSRKQG
EWVPNEYGGRENLEAIEFLRNTNRVLGEQTPGAVTMAEESTDFAGVSRPASTGGLGFWFK
WNLGWMHDTLDYMQLDPVHRRHHHDKMTFGILYNYTENFVLPLSHDEVVHGKKSLLDRMP
GDAWQKFANLRAYYGWMFAFPGKKLLFMGNEFAQGREWNHDASLDWHLLEGDDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDPYGFEWLVVDDHERSVFIFVRRDKAGNEIIVASNFTPV
PRHGYRFGVNQPGRWREELNTDSMHYHGSNTGNGGGVASEAIASHGREHSLSVTLPPLAT
IWLVRESAGQ

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	274	574	2.1e-157	0.9966777408637874
CBM48	124	211	7.6e-22	0.9210526315789473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK12313	PRK12313	0.0	102	726	4	628	1,4-alpha-glucan branching protein GlgB.
COG0296	GlgB	0.0	100	723	1	626	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].
PRK14705	PRK14705	0.0	15	724	513	1221	glycogen branching enzyme; Provisional
PRK14706	PRK14706	0.0	113	729	15	623	glycogen branching enzyme; Provisional
PRK05402	PRK05402	0.0	8	728	4	726	1,4-alpha-glucan branching protein GlgB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJS00573.1	0.0	1	730	1	730
QLS23249.1	0.0	1	730	1	730
QHW71835.1	0.0	1	730	1	730
QLT68143.1	0.0	1	730	1	730
QCB66030.1	0.0	1	730	4	733

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1M7X_A	0.0	112	727	1	616	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
4LPC_A	0.0	117	727	1	611	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
5GQW_A	7.08e-249	20	723	40	771	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
5GR1_A	1.00e-248	20	723	40	771	Crystalstructure of branching enzyme Y500A/D501A mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142],5GR6_A Crystal structure of branching enzyme Y500A/D501A double mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]
5GQZ_A	1.42e-248	20	723	40	771	Crystalstructure of branching enzyme Y500A mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q32AV3	0.0	1	727	1	727	1,4-alpha-glucan branching enzyme GlgB OS=Shigella dysenteriae serotype 1 (strain Sd197) OX=300267 GN=glgB PE=3 SV=1
Q5PM06	0.0	1	726	1	726	1,4-alpha-glucan branching enzyme GlgB OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=glgB PE=3 SV=1
Q57IT8	0.0	1	726	1	726	1,4-alpha-glucan branching enzyme GlgB OS=Salmonella choleraesuis (strain SC-B67) OX=321314 GN=glgB PE=3 SV=1
Q3YW93	0.0	1	727	1	727	1,4-alpha-glucan branching enzyme GlgB OS=Shigella sonnei (strain Ss046) OX=300269 GN=glgB PE=3 SV=1
Q6CZK0	0.0	1	727	1	725	1,4-alpha-glucan branching enzyme GlgB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_04553.