CAZyme Information: MGYG000002491_01712

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_01712
• CAZy Family: GH1
• CAZyme Description: 6-phospho-beta-glucosidase GmuD

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
475	MGYG000002491_5|CGC6	56027.26	6.3056

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 153648; End: 155075 Strand: +

Full Sequence      

MSTQRMTIPDDFILGAAASAWQTEGWSGKKAGQDSWPDLWYKNDRHVWHNGYGPAIATDF
INRFREDVQLMKLAGLTHYRTSINWSRFLTDYEAVTVDEEYAAYYDQLFDELLANGIEPM
ICLEHYELPGYLLEQYGGWGAKKVVELYVRYVEQVFARYHHKVARWFTFNEPIVVQTRVY
LDALRWPYEQNTGKWMQWNHHKVLATAKVVQLFREKGYRGTVGCILNPEVTYPRSSAAHD
RRAAEVYDLFYNRVFLDPLVHGVYPVELFALLEKHGVNWDYSVEELAMIRDNTVDELGIN
LYYPHRVKAPSRAWHPDTPFHPAWYYEPFDLPGRKMNPSRGWEIYPQIVYDMAMRIKSDY
RNIPWFVAESGMGVENEAQFRNADGVIADDYRIRFIRDHLWQTLRAREDGANCHGYMLWA
FTDNVSPMNAFKNRYGLIEIDLDADRARRPKASASWFRQLRDSRVLTMDIDDEWR

Enzyme Prediction     

No EC number prediction in MGYG000002491_01712.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	6	461	4.7e-117	0.9813519813519813

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2723	BglB	3.51e-150	5	471	1	460	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
pfam00232	Glyco_hydro_1	9.26e-110	4	460	1	447	Glycosyl hydrolase family 1.
PRK13511	PRK13511	2.13e-83	7	466	4	468	6-phospho-beta-galactosidase; Provisional
PRK09589	celA	7.67e-67	6	460	2	468	6-phospho-beta-glucosidase; Reviewed
PRK15014	PRK15014	6.97e-61	4	460	2	469	6-phospho-beta-glucosidase BglA; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBR19467.1	0.0	1	475	1	475
BBS95401.1	0.0	1	475	1	475
BBS90378.1	0.0	1	475	1	475
QIR26135.1	0.0	1	475	1	475
BBV64486.1	0.0	1	475	1	475

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4B3K_A	2.32e-126	6	474	1	470	Family1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3K_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_A Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_B Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_C Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_D Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_E Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes],4B3L_F Family 1 6-phospho-beta-D glycosidase from Streptococcus pyogenes [Streptococcus pyogenes]
5FOO_A	1.36e-125	6	474	2	471	6-phospho-beta-glucosidase[Streptococcus pyogenes M1 GAS],5FOO_B 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_C 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_D 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_E 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS],5FOO_F 6-phospho-beta-glucosidase [Streptococcus pyogenes M1 GAS]
5NAV_A	1.19e-111	9	460	21	471	Crystalstructure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_B Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_C Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_D Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_E Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAV_F Crystal structure of the double mutant (Cys211Ser/Cys292Ser) 6-phospho-b-D-glucosidase from Lactobacillus plantarum [Lactiplantibacillus plantarum]
5NAQ_A	4.75e-111	9	460	21	471	Crystalstructure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_B Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_C Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_D Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_E Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum],5NAQ_F Crystal structure of native 6-phospho-glucosidase LpBgl from Lactobacillus plantarum [Lactiplantibacillus plantarum]
6Z1H_A	6.39e-80	2	469	5	453	ChainA, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1H_B Chain B, ANCESTRAL RECONSTRUCTED GLYCOSIDASE [synthetic construct],6Z1M_A Chain A, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_B Chain B, Ancestral reconstructed glycosidase [synthetic construct],6Z1M_C Chain C, Ancestral reconstructed glycosidase [synthetic construct]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O05508	1.97e-129	3	460	4	459	6-phospho-beta-glucosidase GmuD OS=Bacillus subtilis (strain 168) OX=224308 GN=gmuD PE=1 SV=1
P26208	3.32e-62	5	460	3	442	Beta-glucosidase A OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglA PE=1 SV=1
P10482	4.16e-61	6	459	3	448	Beta-glucosidase A OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=bglA PE=3 SV=1
P42403	1.99e-59	7	460	8	469	Aryl-phospho-beta-D-glucosidase BglC OS=Bacillus subtilis (strain 168) OX=224308 GN=bglC PE=1 SV=1
P40740	3.39e-58	1	460	1	461	Aryl-phospho-beta-D-glucosidase BglH OS=Bacillus subtilis (strain 168) OX=224308 GN=bglH PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000078	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_01712.