CAZyme Information: MGYG000002491_01551

Basic Information

• Species: Kluyvera ascorbata_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Kluyvera; Kluyvera ascorbata_B
• CAZyme ID: MGYG000002491_01551
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
382		42458.58	6.8921

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002491	5264779	Isolate	Spain	Europe

• Gene Location: Start: 290094; End: 291242 Strand: +

Full Sequence      

MTEQRPLTIALVAGETSGDILGAGLIRALKARVPDARFVGVAGPRMQAEGCEAWYEMEEL
AVMGIVEVLGRLRRLLHIRADLTQRFTDLKPDVFVGIDAPDFNITLEGNLKKQGIKTIHY
VSPSVWAWRQKRVFKIGRATDLVLAFLPFEKAFYDKFNVPCRFIGHTMADAMPLDPDKNA
ARDTLGIAHDVHCLAMLPGSRGAEVEMLSADFLKTAQLLRQQYPDLEVVVPLVNAKRREQ
FERIKAEVAPDLAVRMLDGMAREAMIASDAALLASGTAALECMLAKCPMVVGYRMKPFTF
WLAKRLVKTDYVSLPNLLAGRELVKELLQDECQPTLLAEALQPLLANGKTSHAMHDTFRE
LHLQIRCNADEQAADAVLELAR

Enzyme Prediction     

No EC number prediction in MGYG000002491_01551.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	9	366	5.1e-141	0.9943502824858758

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR00215	lpxB	0.0	1	380	1	385	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
COG0763	LpxB	0.0	6	382	1	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
PRK00025	lpxB	0.0	6	382	1	376	lipid-A-disaccharide synthase; Reviewed
pfam02684	LpxB	0.0	9	377	1	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK01021	lpxB	1.84e-48	11	369	231	593	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBT72476.1	2.22e-277	1	382	1	382
BBR22394.1	2.22e-277	1	382	1	382
BBQ85405.1	2.22e-277	1	382	1	382
BBT03264.1	6.35e-277	1	382	1	382
BBR60440.1	6.35e-277	1	382	1	382

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.96e-254	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.61e-253	1	382	1	382	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B5RHG7	1.28e-261	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=lpxB PE=3 SV=1
B4TK57	1.28e-261	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=lpxB PE=3 SV=1
B4TYE2	1.28e-261	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella schwarzengrund (strain CVM19633) OX=439843 GN=lpxB PE=3 SV=1
B4SV11	1.28e-261	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella newport (strain SL254) OX=423368 GN=lpxB PE=3 SV=1
B5R421	1.28e-261	1	382	1	382	Lipid-A-disaccharide synthase OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000022	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002491_01551.