CAZyme Information: MGYG000002490_03299

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_03299
• CAZy Family: GT1
• CAZyme Description: Demethyllactenocin mycarosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
402	MGYG000002490_30|CGC2	45016.7	7.6753

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 66716; End: 67924 Strand: +

Full Sequence      

MSKIVFFSIPAHGHTNPTIPVVTELVNRGHQVWYYSFLEFQGKIEGAGAAFIACDEFLPQ
LSQKELNRKVGKDFAALIEMVADTTIALDEKVCKELREIQPDCIVSDSVCFWGKLFAKKL
GIPYICSTTTFAFNQHTAKLMKRGFIELWRMIVGLPRINKKIQLLKDHGYEVENFVSIIQ
NNNETDTIVYTAKEFQPMASTFSERYAFVGPSIRQSPPVQNNKKDRKIIYISLGTVLNQN
QDFYQNLIRAFADTDYDVVMSVGEKTEISSLGNIPGNFAVKNFVDQISVLQTADVFITHC
GMNSANESLYFGVPMVLFPQHSEQRLVADRVAELGAGLKLQGKKPKYLAEAVSEVLANRT
YQENAQKLSETFQNAGGAVEAANVILSKIREKITNTGSPQMK

Enzyme Prediction     

No EC number prediction in MGYG000002490_03299.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT1	65	387	1.6e-45	0.8219895287958116

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR01426	MGT	5.23e-109	7	391	1	392	glycosyltransferase, MGT family. This model describes the MGT (macroside glycosyltransferase) subfamily of the UDP-glucuronosyltransferase family. Members include a number of glucosyl transferases for macrolide antibiotic inactivation, but also include transferases of glucose-related sugars for macrolide antibiotic production. [Cellular processes, Toxin production and resistance]
COG1819	YjiC	4.05e-74	1	392	1	402	UDP:flavonoid glycosyltransferase YjiC, YdhE family [Carbohydrate transport and metabolism].
cd03784	GT1_Gtf-like	6.07e-71	3	384	2	401	UDP-glycosyltransferases and similar proteins. This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin. Gtfs transfer sugar moieties from an activated NDP-sugar donor to the oxidatively cross-linked heptapeptide core of vancomycin group antibiotics. The core structure is important for the bioactivity of the antibiotics.
PHA03392	egt	9.79e-16	222	368	292	442	ecdysteroid UDP-glucosyltransferase; Provisional
cd03785	GT28_MurG	3.84e-12	13	369	11	339	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase. MurG (EC 2.4.1.227) is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide (NAM). The resulting disaccharide is then transported across the cell membrane, where it is polymerized into NAG-NAM cell-wall repeat structure. MurG belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains, each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM45718.1	5.65e-297	1	402	1	402
SYX81875.1	8.77e-260	1	392	1	392
QAS55940.1	1.25e-236	1	392	1	392
QPA51956.1	3.57e-236	1	392	1	392
AMR91286.1	3.57e-236	1	392	1	392

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6KQW_A	1.04e-58	4	382	6	378	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
6KQX_A	1.18e-58	4	382	6	378	ChainA, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168],7BOV_A Chain A, Uncharacterized UDP-glucosyltransferase YjiC [Bacillus subtilis subsp. subtilis str. 168]
2IYA_A	6.19e-47	4	385	15	416	Thecrystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus],2IYA_B The crystal structure of macrolide glycosyltransferases: A blueprint for antibiotic engineering [Streptomyces antibioticus]
3IA7_A	3.16e-42	4	385	7	393	CrystalStructure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora],3IA7_B Crystal Structure of CalG4, the Calicheamicin Glycosyltransferase [Micromonospora echinospora]
6J31_A	1.49e-39	4	385	7	390	CrystalStructure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_B Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_C Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora],6J31_D Crystal Structure Analysis of the Glycotransferase of kitacinnamycin [Kitasatospora]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O31853	3.38e-66	1	392	1	399	Uncharacterized UDP-glucosyltransferase YojK OS=Bacillus subtilis (strain 168) OX=224308 GN=yojK PE=3 SV=2
O34539	6.46e-58	4	382	6	378	NDP-glycosyltransferase YjiC OS=Bacillus subtilis (strain 168) OX=224308 GN=yjiC PE=1 SV=1
Q65JC2	4.46e-55	4	385	6	386	NDP-glycosyltransferase YjiC OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / CCUG 7422 / NBRC 12200 / NCIMB 9375 / NCTC 10341 / NRRL NRS-1264 / Gibson 46) OX=279010 GN=yjiC PE=1 SV=1
O05496	2.36e-54	1	392	1	393	Uncharacterized UDP-glucosyltransferase YdhE OS=Bacillus subtilis (strain 168) OX=224308 GN=ydhE PE=3 SV=2
Q9XC67	1.40e-43	1	385	58	453	Demethyllactenocin mycarosyltransferase OS=Streptomyces fradiae OX=1906 GN=tylCV PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002490_03299.