CAZyme Information: MGYG000002490_02991

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_02991
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
422	MGYG000002490_27|CGC2	45930.66	5.5906

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 106386; End: 107654 Strand: +

Full Sequence      

MKKRRYIYSMLAALCIAAMLFPQQAAQAAGEPKQAEGTKIVLDGYPLEFSAKPTIIQGTT
MVPFRGIAEALGIEVKWDSKTKTVAAKQTTADGEKSVLLQLNQKTAKVDGQAVALSMAPL
AKAGTTYIPLSFFGKQFGAKVSWDAAAKTVSIQSPPKKMYSMTYYAIASFKERHLLTQFD
TAAFGWARLQEDSTITTSGKDFYWPEPAGEITPESIVDGAKQDGTSPYLMVFASDRKNEL
TNMLEDEALADKAREDIIELAQDKGFSGIALDFEGLGLSGDIAKAKQDYNRFVAQLAKQA
AAANLKLTLVLHPLNGAYQGYDYKTLASEADDIIIMAYAYEDEKAPEPLDKVDEAIQLAL
KEVTRDQLILGLSMGSENSKSVSSVIGLAKRHNLKGTAIWRLGLIGEDTMAQVEKSIVPL
KQ

Enzyme Prediction     

No EC number prediction in MGYG000002490_02991.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	192	373	6.6e-17	0.5

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07833	Cu_amine_oxidN1	8.78e-32	56	152	1	93	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
cd02874	GH18_CFLE_spore_hydrolase	2.10e-18	180	404	27	304	Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination. CFLE is expressed as an inactive preprotein (called SleB) in the forespore compartment of sporulating cells. SleB translocates across the forespore inner membrane and is deposited as a mature enzyme in the cortex layer of the spore. As part of a sensory mechanism capable of initiating germination, CFLE degrades a spore-specific peptidoglycan constituent called muramic-acid delta-lactam that comprises the outer cortex. CFLE has a C-terminal glycosyl hydrolase family 18 (GH18) catalytic domain as well as two N-terminal LysM peptidoglycan-binding domains. In addition to SleB, this family includes YaaH, YdhD, and YvbX from Bacillus subtilis.
pfam07833	Cu_amine_oxidN1	3.33e-10	38	84	45	91	Copper amine oxidase N-terminal domain. Copper amine oxidases catalyze the oxidative deamination of primary amines to the corresponding aldehydes, while reducing molecular oxygen to hydrogen peroxide. These enzymes are dimers of identical subunits, each comprising four domains. The N-terminal domain, which is absent in some amine oxidases, consists of a five-stranded antiparallel beta sheet twisted around an alpha helix. The D1 domains from the two subunits comprise the 'stalk' of the mushroom-shaped dimer, and interact with each other but do not pack tightly against each other.
COG3858	YaaH	1.77e-08	242	404	184	409	Spore germination protein YaaH [Cell cycle control, cell division, chromosome partitioning].
cd00598	GH18_chitinase-like	2.87e-05	176	403	21	208	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM45581.1	2.94e-300	1	422	1	422
SYX87256.1	8.67e-210	1	421	1	422
QUO42548.1	2.05e-157	13	417	11	410
QQE75522.1	2.05e-157	13	417	11	410
QYR22488.1	2.80e-157	14	418	12	418

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000326	0.998888	0.000229	0.000222	0.000179	0.000146

TMHMM  Annotations     

start	end
7	26