CAZyme Information: MGYG000002490_00381

Basic Information

• Species: Paenibacillus_B thiaminolyticus
• Lineage: Bacteria; Firmicutes; Bacilli; Paenibacillales; Paenibacillaceae; Paenibacillus_B; Paenibacillus_B thiaminolyticus
• CAZyme ID: MGYG000002490_00381
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
827	MGYG000002490_5|CGC1	95836.91	4.9215

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002490	6537383	Isolate	Japan	Asia

• Gene Location: Start: 118157; End: 120640 Strand: -

Full Sequence      

MIKLDLNGMWRMKSALEEDWIPAQVPGSVASDLLRAGLIPDPYYKEQEYEVFGHFYNDYE
YEREFWVEPSLLEAADQLELCCEGLDTIADIHLNGVQLAHTFNMHRTYRFAVDELITPGH
NLLHIRFHSPVQYVERKQKELALWAANGDYVVQGFPHLRKAHHMFGWDWGPKLPDSGIWR
DIYLAAYEKGRLDDVYLTQKHQESGSVMLDIRVSVEQYGNAPLELITELTAPDGNRLVSD
ARPIAGGTDHIQLHVDEPELWWPNGLGEQPLYELKLWLRSGSATVDDQVYRVGLRTLTVR
NEPDQWGESFEFVINGVSIFAMGANYIPEDNIRDRHSIERTERLIRDCVEAHFNCIRVWG
GGFYPDDYFYDLCDQYGLIVWQDHMFACAEYEMNEEFSKEIISEIADNVRRIRHHASLGL
WCGNNEMEMAWVDWDFPKREKLKTDYVKQFEIIIPEITKAHDPNTFYWKASPSSGGGFDE
PNAYHRGDVHYWEVWHGDKKFTEYRKHYFRFCSEFGFQSFPLLKTVRTFTEPGDRNIFTP
VMESHQKNEAGNGKILAGISDNFLNPKDFSSLLYVSQLLQAEAMRYGVEHWRRNRGRCMG
SIYWQLNDCWPVASWSSLDYYGRWKALHYSAKRFHAPVLLSAEEEGSQVKLCVTNDTRDQ
VKGTVVWRLRDGSSAIVQQGSIDMEANPLSAREWVTLDFSDVIVSDKIKRNVYVEYELLV
DGAVVSDGYALFVKPKHYQLQQPELHAVVSEEDDCFVIQVQASQLALFVELDFTNIDAIF
EDNYFHVSAGEPKQIRVMKANLSKPASLRTLQDELQIRSLFDSYLTL

Enzyme Prediction     

No EC number prediction in MGYG000002490_00381.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	4	733	3.9e-109	0.738031914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	7.91e-111	5	773	14	763	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	3.60e-22	742	822	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
pfam17786	Mannosidase_ig	2.46e-16	647	737	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.
PRK10340	ebgA	3.78e-13	176	426	195	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	4.85e-11	191	295	2	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDM44823.1	0.0	1	827	1	827
AJY74274.1	0.0	1	824	1	828
QUH28340.1	0.0	1	822	1	817
AUG59052.1	0.0	4	823	3	817
AWB45455.1	0.0	1	822	1	816

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6BYE_A	2.40e-173	1	820	3	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306],6BYE_B Crystal structure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri in complex with mannose [Xanthomonas citri pv. citri str. 306]
6BYC_A	2.47e-173	1	820	3	850	Crystalstructure of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYI_A	1.78e-172	1	820	1	848	Crystalstructure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYI_B Crystal structure of the acid-base mutant (E477A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
6BYG_A	1.83e-172	1	820	3	850	Crystalstructure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306],6BYG_B Crystal structure of the nucleophile mutant (E575A) of the GH2 exo-beta-mannanase from Xanthomonas axonopodis pv. citri [Xanthomonas citri pv. citri str. 306]
2VJX_A	5.82e-163	6	808	11	827	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q95327	5.51e-113	1	824	20	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
Q29444	1.15e-110	1	824	20	879	Beta-mannosidase OS=Bos taurus OX=9913 GN=MANBA PE=1 SV=1
O00462	4.50e-109	2	824	21	879	Beta-mannosidase OS=Homo sapiens OX=9606 GN=MANBA PE=1 SV=3
Q0CCA0	4.19e-107	10	726	13	755	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
A1CGA8	2.44e-104	3	695	6	751	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002490_00381.