CAZyme Information: MGYG000002489_00738

Basic Information

• Species: Neisseria gonorrhoeae
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Neisseriaceae; Neisseria; Neisseria gonorrhoeae
• CAZyme ID: MGYG000002489_00738
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
223	MGYG000002489_4|CGC2	25176.15	11.2036

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002489	2153911	Isolate	Canada	North America

• Gene Location: Start: 120047; End: 120718 Strand: -

Full Sequence      

MPFETRRRLQAALPQQTATVFRHTAHYPTPSRTNPAPTGAGRNHKGTMMKLKIDIATNNF
KHGGGTERYTLDLVKGLNRQNITPAVYATKFDHGIPEYAMIEPHLVDQRRTLKKLRSFLF
SSRLAQTRKNSAAKLIACHHADYADLLICGGTHLGYLHHMAQKPNLLDRLAIRRNRSNYA
TAKLIVAHSHMMRRELVGLYGVPPERIQVAPPPRRYGTLLSTT

Enzyme Prediction     

No EC number prediction in MGYG000002489_00738.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13439	Glyco_transf_4	1.09e-12	64	213	2	165	Glycosyltransferase Family 4.
cd03801	GT4_PimA-like	3.96e-08	55	213	5	172	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	1.15e-07	52	212	1	169	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03811	GT4_GT28_WabH-like	1.56e-06	52	213	1	167	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
pfam13579	Glyco_trans_4_4	1.35e-04	64	213	1	158	Glycosyl transferase 4-like domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBH58138.1	1.84e-162	1	223	1	223
SBO56511.1	1.84e-162	1	223	1	223
SBQ23088.1	1.84e-162	1	223	1	223
BBH60413.1	1.84e-162	1	223	1	223
ACF31134.1	1.84e-162	1	223	1	223

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q2SZV9	3.83e-33	51	213	1	164	Probable transglycosylase BTH_I0986 OS=Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264) OX=271848 GN=BTH_I0986 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000052	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002489_00738.