CAZyme Information: MGYG000002488_01920

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_01920
• CAZy Family: GT51
• CAZyme Description: Penicillin-binding protein 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
524		57296.31	5.246

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 664231; End: 665805 Strand: -

Full Sequence      

MAIIMDASYSKDRILELYLNEVFLGQSGDEQIRGFPLASLYYFGRPVDELSLDQQALLVG
MVKGASAYNPWRNPKSALERRNVVLKLLQTQEIIDQELYNVLSARPLGVKPRSEALTPQP
AFMQLVRQELQTTLGDKVKDLSGTKIFTTLDPVSQDAAEKAVEVGVADIRKVRKIDDLEG
AMVVVDRLSGEVRALVGGSQPQYAGFNRALSARRSIGSLAKPATYLTALSEPERFRLNTW
LADEPISVPIPGGKPWQPRNYDRGYKGKLMLVDALATSRNVPTVNLGLEVGLDRVIQTWI
NLGAPAENLEKVPAMLLGALNLTPMEVAQTFQTIGSLGNRAKLSSLRSVIAQDGTVLYQS
YPQAETTVSPQAAYMTLFGMQQVVNSGTAWRVLKPKFGNYNLAGKTGTTNDLRDSWFAGI
DGKEVTISWMGRDNNGPTNLTGSTGALLLYRNYLQNQAPLKLNPPAPEDIAEMSVDAQGN
FACYGGGVRTLPVWTANPDGLCTPVQQDTDESGAPKWLQDLFSE

Enzyme Prediction     

EC	2.4.1.129

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	1	87	5.2e-23	0.4632768361581921

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02071	PBP_1b	0.0	1	502	227	729	penicillin-binding protein 1B. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of a particular bifunctional transglycosylase/transpeptidase in E. coli and other Proteobacteria, designated penicillin-binding protein 1B. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
PRK09506	mrcB	0.0	1	524	291	830	bifunctional glycosyl transferase/transpeptidase; Reviewed
PRK14850	PRK14850	0.0	1	522	237	764	penicillin-binding protein 1b; Provisional
COG0744	MrcB	8.90e-164	1	504	157	639	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
TIGR02074	PBP_1a_fam	5.63e-116	1	454	82	525	penicillin-binding protein, 1A family. Bacterial that synthesize a cell wall of peptidoglycan (murein) generally have several transglycosylases and transpeptidases for the task. This family consists of bifunctional transglycosylase/transpeptidase penicillin-binding proteins (PBP). In the Proteobacteria, this family includes PBP 1A but not the paralogous PBP 1B (TIGR02071). This family also includes related proteins, often designated PBP 1A, from other bacterial lineages. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPT34841.1	0.0	1	524	245	768
QNH66437.1	0.0	1	524	245	768
QIF97223.1	0.0	1	524	245	768
QUT02620.1	0.0	1	524	245	768
QJW50137.1	0.0	1	524	245	768

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FGZ_A	1.82e-248	1	502	236	737	E.coli PBP1b in complex with FPI-1465 [Escherichia coli K-12],5HL9_A E. coli PBP1b in complex with acyl-ampicillin and moenomycin [Escherichia coli K-12],5HLA_A E. coli PBP1b in complex with acyl-cephalexin and moenomycin [Escherichia coli K-12],5HLB_A E. coli PBP1b in complex with acyl-aztreonam and moenomycin [Escherichia coli K-12],5HLD_A E. coli PBP1b in complex with acyl-CENTA and moenomycin [Escherichia coli K-12],6YN0_A Structure of E. coli PBP1b with a FtsN peptide activating transglycosylase activity [Escherichia coli K-12],7LQ6_A Chain A, Penicillin-binding protein 1B [Escherichia coli K-12]
3VMA_A	3.70e-248	1	502	257	758	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli K-12]
3FWL_A	2.09e-238	2	502	241	741	CrystalStructure of the Full-Length Transglycosylase PBP1b from Escherichia coli [Escherichia coli]
3UDF_A	1.31e-45	5	454	123	712	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
4OON_A	1.67e-42	1	454	119	719	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P02919	5.51e-248	1	515	293	807	Penicillin-binding protein 1B OS=Escherichia coli (strain K12) OX=83333 GN=mrcB PE=1 SV=2
P57296	5.55e-183	1	522	234	760	Penicillin-binding protein 1B OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) OX=107806 GN=mrcB PE=3 SV=1
Q89AR2	5.61e-181	1	503	237	741	Penicillin-binding protein 1B OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) OX=224915 GN=mrcB PE=3 SV=1
P45345	6.61e-167	1	515	248	764	Penicillin-binding protein 1B OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=mrcB PE=3 SV=1
Q9KUC0	2.67e-156	1	522	260	775	Penicillin-binding protein 1B OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) OX=243277 GN=mrcB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_01920.