CAZyme Information: MGYG000002488_01365

Basic Information

• Species: Proteus penneri
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Proteus; Proteus penneri
• CAZyme ID: MGYG000002488_01365
• CAZy Family: GT2
• CAZyme Description: Acetyl-coenzyme A synthetase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
345	MGYG000002488_3|CGC1	38068.41	4.6727

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000002488	3747729	Isolate	United States	North America

• Gene Location: Start: 211363; End: 212400 Strand: -

Full Sequence      

MAIYMPMVPEAAVAMLACTRIGAIHSVIFGGFSPEAVAGRIIDSKAKLVITADEGLRAGR
AIPLKKNVDDALNHADIPPINHVVVFRRTGHTEQWIDGRDVWWDEIIQDVSTECEVEVMD
AEDPLFILYTSGSTGKPKGVLHTTGGYLVYASMTFKYTFDYHEGDIYWCTADVGWVTGHS
YLLYGPLSNGATTVMFEGVPNYPSVNRMAQIVDKHQINILYTAPTAIRALMAEGDKAIED
TQRTSLRILGSVGEPINPEAWEWFYQKMGRSQCPIVDTWWQTETGGFMITPLPGAMDLKP
GSATRPFFGVQPAIVDNMGEVQQGACEGNLVITDSWPGQARTLFW

Enzyme Prediction     

No EC number prediction in MGYG000002488_01365.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd17634	ACS-like	0.0	1	345	112	455	acetate-CoA ligase. This family includes acyl- and aryl-CoA ligases, as well as the adenylation domain of nonribosomal peptide synthetases and firefly luciferases. The adenylate-forming enzymes catalyze an ATP-dependent two-step reaction to first activate a carboxylate substrate as an adenylate and then transfer the carboxylate to the pantetheine group of either coenzyme A or an acyl-carrier protein. The active site of the domain is located at the interface of a large N-terminal subdomain and a smaller C-terminal subdomain.
cd05966	ACS	0.0	2	344	113	453	Acetyl-CoA synthetase (also known as acetate-CoA ligase and acetyl-activating enzyme). Acetyl-CoA synthetase (ACS, EC 6.2.1.1, acetate#CoA ligase or acetate:CoA ligase (AMP-forming)) catalyzes the formation of acetyl-CoA from acetate, CoA, and ATP. Synthesis of acetyl-CoA is carried out in a two-step reaction. In the first step, the enzyme catalyzes the synthesis of acetyl-AMP intermediate from acetate and ATP. In the second step, acetyl-AMP reacts with CoA to produce acetyl-CoA. This enzyme is widely present in all living organisms. The activity of this enzyme is crucial for maintaining the required levels of acetyl-CoA, a key intermediate in many important biosynthetic and catabolic processes. Acetyl-CoA is used in the biosynthesis of glucose, fatty acids, and cholesterol. It can also be used in the production of energy in the citric acid cycle. Eukaryotes typically have two isoforms of acetyl-CoA synthetase, a cytosolic form involved in biosynthetic processes and a mitochondrial form primarily involved in energy generation.
PRK00174	PRK00174	0.0	2	344	127	467	acetyl-CoA synthetase; Provisional
TIGR02188	Ac_CoA_lig_AcsA	0.0	2	344	117	460	acetate--CoA ligase. This model describes acetate-CoA ligase (EC 6.2.1.1), also called acetyl-CoA synthetase and acetyl-activating enzyme. It catalyzes the reaction ATP + acetate + CoA = AMP + diphosphate + acetyl-CoA and belongs to the family of AMP-binding enzymes described by pfam00501.
PLN02654	PLN02654	4.13e-169	1	344	148	497	acetate-CoA ligase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAE6201330.1	2.37e-140	3	344	699	1046
CAE6201338.1	2.92e-140	3	344	710	1057
AFY93865.1	3.35e-08	34	284	388	638

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P2F_A	1.41e-205	2	344	136	478	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2F_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2Q_A	1.41e-205	2	344	136	478	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2Q_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P2J_A	1.41e-205	2	344	136	478	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P2J_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
2P20_A	1.41e-205	2	344	136	478	ChainA, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium],2P20_B Chain B, Acetyl-coenzyme A synthetase [Salmonella enterica subsp. enterica serovar Typhimurium]
5JRH_A	1.85e-205	2	344	136	478	Crystalstructure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5JRH_B Crystal structure of Salmonella enterica acetyl-CoA synthetase (Acs) in complex with cAMP and Coenzyme A [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1JIK3	8.15e-212	2	344	136	478	Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=acs PE=3 SV=1
A8G8G7	1.16e-211	2	344	136	478	Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) OX=399741 GN=acs PE=3 SV=1
Q7MBA6	1.49e-209	2	344	136	478	Acetyl-coenzyme A synthetase OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=acs PE=3 SV=1
Q1CE37	8.82e-209	2	344	136	478	Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=acs PE=3 SV=1
Q66FM8	8.82e-209	2	344	136	478	Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=acs PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000002488_01365.